KEGG   Mus musculus (house mouse): 14230
Entry
14230             CDS       T01002                                 
Symbol
Fkbp10, AI325255, FKBP-10, FKBP-65, FKBP65, Fkbp-rs1, Fkbp1-rs, Fkbp6, Fkbprp
Name
(RefSeq) FK506 binding protein 10
  KO
K09575  FK506-binding protein 9/10 [EC:5.2.1.8]
Organism
mmu  Mus musculus (house mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    14230 (Fkbp10)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     14230 (Fkbp10)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    14230 (Fkbp10)
SSDB
Motif
Pfam: FKBP_C EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 14230
NCBI-ProteinID: NP_034351
MGI: 104769
Ensembl: ENSMUSG00000001555
UniProt: Q61576
Position
11:100306520..100315666
AA seq 581 aa
MFLVGSSSHTLHRLRILPLLLLLQTLERGLGRASPAGAPLEDVVIERYHIPRACPREVQM
GDFVRYHYNGTFEDGKKFDSSYDRSTLVAIVVGVGRLITGMDRGLMGMCVNERRRLIVPP
HLGYGSIGVAGLIPPDATLYFDVVLLDVWNKADTVQSTILLRPPYCPRMVQNSDFVRYHY
NGTLLDGTAFDNSYSRGGTYDTYIGSGWLIKGMDQGLLGMCPGEKRKIIIPPFLAYGEKG
YGTVIPPQASLVFYVLLLDVHNPKDTVQLETLELPQGCVRRAVAGDFMRYHYNGSLMDGT
LFDSSYSRNHTYNTYVGQGYIIPGMDQGLQGACIGERRRITVPPHLAYGENGTGDKIPGS
AVLIFDVHVIDFHNPSDPVEIKTLSRPPENCNETSKIGDFIRYHYNCSLLDGTRLFSSHD
YEAPQEITLGANKVIEGLDRGLQGMCVGERRQLIVPPHLAHGENGARGVPGSAVLLFEVE
LVSREDGLPTGYLFVWYQDPSTSLFEDMDLNKDGEVPPEEFSSFIKAQVNEGKGRLMPGQ
DPDKTISDMFQNQDRNQDGKITAEELKLKSDEDQERVHEEL
NT seq 1746 nt   +upstreamnt  +downstreamnt
atgttccttgtggggtcctccagccacaccctccatcggctccgcatactgccgttgctg
ttgcttctacagaccttggagaggggactgggccgtgccagcccggccggagcccccttg
gaagatgtggtcatcgagagataccacatccctcgggcctgtccccgagaagtgcagatg
ggggattttgtgcgttaccactacaatggcactttcgaagacgggaaaaagtttgactcc
agctatgaccgtagcaccctggtggccatcgttgtgggcgtaggccgcctcatcaccggc
atggaccggggtctcatgggcatgtgtgtcaacgagcgccgccgcctcattgtgcctccc
cacctgggctacggcagcatcggtgtggcgggcctcatcccccctgatgccaccctctat
tttgacgtggtcctgctggacgtgtggaacaaagcagacacggtgcagtcaactatcctc
ctgcgccctccctactgcccccgaatggtgcagaacagtgactttgtgcgctatcactac
aatggcactctgctggatggcactgcctttgacaacagctacagtaggggaggcacttat
gacacctacatcggctctggttggctgatcaaaggcatggaccaggggctgctgggcatg
tgccctggagagaaaaggaagatcattatccctcccttcctggcttatggggagaaaggc
tatgggactgtgatacccccgcaggcctccctggtcttctatgtcctgctgctggatgtc
cacaacccgaaggacacggtccagctggagacgctggagctgccccagggctgtgtccgg
cgagctgtggcgggggacttcatgcgttaccactacaatggctctttgatggatggtacc
ctctttgattccagctactcccgaaaccacacctacaatacctatgtcgggcagggttac
atcatccctgggatggaccaggggctgcaaggcgcatgcataggggagcgaaggaggatt
actgtgccccctcaccttgcctacggggagaatgggacaggagacaagatccctggctcg
gctgtgctcatcttcgatgtgcacgtcatcgacttccacaacccttcggaccctgtggaa
atcaagacgctgtcccggcctcctgagaactgcaatgagacatccaaaatcggggacttc
attcgctaccactacaactgttctctgctggacggcaccaggctcttctcgtcccacgac
tatgaggcccctcaagagatcaccctcggagccaacaaagtgatcgaaggtctggacagg
ggcctgcagggcatgtgtgtaggagagaggaggcagctcattgtgcccccacacctggcc
cacggggagaatggagcccggggtgtccctggcagtgctgtgctgctatttgaggtggag
ctggtatcccgagaggatggcctgcccacaggctacctgtttgtgtggtaccaggatcct
tccactagcctttttgaagacatggatctcaataaagatggagaggtgcccccagaagag
ttctcttccttcatcaaggctcaagtgaatgaaggcaaaggacgcctcatgcctgggcaa
gacccagacaaaaccatcagtgacatgtttcagaaccaggaccggaaccaggatggcaag
atcacagctgaggagctcaagctgaagtcagatgaggaccaggagcgggtccatgaggag
ctctga

DBGET integrated database retrieval system