KEGG   Mus musculus (mouse): 14232Help
Entry
14232             CDS       T01002                                 

Gene name
Fkbp8, 38kDa, FKBP-38, FKBP-8, FKBPR38, Fkbp38, mFKBP38
Definition
(RefSeq) FK506 binding protein 8
  KO
K09574  FK506-binding protein 8 [EC:5.2.1.8]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    14232 (Fkbp8)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    14232 (Fkbp8)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     14232 (Fkbp8)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     14232 (Fkbp8)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    14232 (Fkbp8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C TPR_1 TPR_2 TPR_14 Fis1_TPR_C TPR_16 TPR_11 TPR_7 TPR_8 TPR_19 TPR_9 TPR_12 TPR_17 TPR_6 ANAPC3 TPR_20 NARP1 TPR_15 BTAD
Motif
Other DBs
NCBI-GeneID: 14232
NCBI-ProteinID: NP_034353
MGI: 1341070
Ensembl: ENSMUSG00000019428
Vega: OTTMUSG00000031159
UniProt: O35465
Position
8; 8 B3.3
AA seq 402 aa AA seqDB search
MASWAEPSEPAALRLPGAPLLEGFEVLDGVDDAEEEDDLSGLPPLEDMGQPTVEEAEQPG
ALAREFLAATEPEPAPAPAPEEWLDILGNGLLRMKTLVPGPKGSSRPLKGQVVTVHLQMS
LENGTRVQEEPELAFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRSPYIPP
HAALCLEVTLKTAEDGPDLEMLSGQERVALANRKRECGNAHYQRADFVLAANSYDLAIKA
ITSNTKVDMTCEEEEELLQLKVKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKALF
RKGKVLAQQGEYSEAIPILRAALKLEPSNKTIHAELSKLVKKRAAQRSTETALYRKMLGN
PSRLPAKCPGKGAWSIPWKWLFGATAVALGGVALSVVIAARN
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcttgggctgagccctctgagcctgctgccctgcgacttcctggggccccactg
ctggagggctttgaggtgctcgatggggttgatgatgcagaggaggaagatgacctaagt
gggctgccaccactagaggacatgggacagcctacagtggaggaggctgagcagcctgga
gccctggctcgggagttcctggcagccacagagcctgagccagccccagccccagccccg
gaagagtggctggacattctggggaacggattgctgcggatgaagacactggtcccaggc
ccgaaaggctctagccgcccactcaagggccaggtggtgaccgttcacctgcagatgtcc
ctggagaatggcacccgtgtacaggaagagcctgaactggccttcacgctgggagactgc
gatgttatccaggccctggacctcagtgtcccgctcatggatgtgggcgagacagccatg
gttaccgctgactccaagtactgctacggcccccagggcaggagcccatacatccccccc
cacgcagccctgtgcctggaagtcaccctgaagacggcagaggatggacccgacctggag
atgctgagtgggcaggagcgcgtggccctggccaaccgcaagcgggagtgtggcaatgcc
cactaccagcgtgccgactttgtgctggccgccaattcctatgacctggccatcaaggct
atcacctccaacaccaaagtggacatgacttgtgaggaggaagaggagctgctacagctg
aaggtcaagtgtctgaacaaccttgcggcctcacagctgaagctggaccactaccgagca
gctctgcgctcctgtagccaggtgctggagcaccagccggacaacatcaaggcactgttc
cgcaagggcaaggtgctggctcagcaaggtgaatatagtgaggccatcccaatcctgagg
gctgccctgaagctggaaccttccaacaagacgatccacgcagagctctcaaagctggta
aagaagcgtgctgcacagcggagcacagagaccgccctgtaccgaaagatgctaggcaac
cccagccggctgcctgccaagtgtccgggaaagggggcctggtccatcccgtggaaatgg
ctgtttggggcgactgccgtggccctggggggcgtggctctctctgtggtcattgctgcc
aggaactga

DBGET integrated database retrieval system