KEGG   Mus musculus (mouse): 14251Help
Entry
14251             CDS       T01002                                 

Gene name
Flot1, reggie-2
Definition
(RefSeq) flotillin 1
  KO
K07192  flotillin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    14251 (Flot1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14251 (Flot1)
   03036 Chromosome and associated proteins [BR:mmu03036]
    14251 (Flot1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14251 (Flot1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    14251 (Flot1)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    14251 (Flot1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14251 (Flot1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Flot
Motif
Other DBs
NCBI-GeneID: 14251
NCBI-ProteinID: NP_032053
MGI: 1100500
Ensembl: ENSMUSG00000059714
Vega: OTTMUSG00000037406
UniProt: O08917 Q540I4
Position
17; 17 B1
AA seq 428 aa AA seqDB search
MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHG
VPISVTGIAQVKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEI
YKDRQKFSEQVFKVASSDLVNMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGE
AEAKRDAGIREAKAKQEKVSAQCLSEIEMAKAQRDYELKKATYDIEVNTRRAQADLAYQL
QVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELEARVRKPAEAERYRLERLAEA
EKAQLIMQAEAEAESVRMRGEAEAFAIGARARAEAEQMAKKAEAFQMYQEAAQLDMLLEK
LPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILSRLPESVERLTGVSISQVN
HNKPLRTA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtttttcacttgtggcccaaatgaggccatggtggtctccgggttctgcaggagcccc
ccagtcatggtggccggaggccgagtgtttgtcctaccctgcattcagcaaatccagagg
atctctctcaacacactgaccctcaatgtcaagagtgaaaaggtttatacccgccacggg
gtccccatctcagtcacgggcattgcccaggtgaaaatccagggccagaacaaggagatg
ctggcagctgcctgccagatgttcctggggaagacagaggcggagattgcccacattgcc
ctggagacactggaaggccaccagagggcaatcatggcccacatgactgtggaggagatc
tataaggatagacagaaattctcagagcaggttttcaaagtggcctcctccgacctggtc
aacatgggtatcagcgtggttagctacactttgaaggatattcatgatgaccaggattac
ttacactcgttaggaaaggctcgcacggcacaagtccaaaaagatgctcggattggcgaa
gcagaggccaagagagatgccgggatacgggaggctaaggccaagcaggagaaggtatct
gcacagtgcctcagtgaaatagagatggccaaggcacagagggactatgagctgaagaaa
gccacctacgacatcgaggtcaacacccggcgagcacaggctgacctggcctatcagctg
caggtggccaagacgaagcagcagatcgaggagcagcgggtgcaggtgcaggtggttgag
cgcgcccagcaggtggcagtgcaggagcaggagatcgcccggcgcgagaaggagttggag
gctcgcgtgcgcaagccagcagaggctgagcgctacaggctggagcgcctggcggaagca
gagaaggcccagctgatcatgcaggcagaagccgaagctgagtctgtgcggatgcgaggg
gaagctgaggcctttgctataggtgcccgcgctcgtgctgaggctgagcaaatggccaag
aaggcagaagccttccagatgtaccaggaggccgcccagctggacatgctgctggagaaa
ctgccccaggtggcagaagagatcagtggtcccctgacctcagccaataagatcacgctg
gtgtctagtggaagcggaaccatgggggcagccaaagttactggggaagtactggacatc
ttgagccgcctgccggagagtgtggagaggctcacaggcgtcagcatctcccaggtaaat
cacaacaagcctttaaggacagcgtga

DBGET integrated database retrieval system