KEGG   Mus musculus (house mouse): 14252
Entry
14252             CDS       T01002                                 
Symbol
Flot2, AI573412, Esa, reggie-2
Name
(RefSeq) flotillin 2
  KO
K07192  flotillin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    14252 (Flot2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14252 (Flot2)
   03036 Chromosome and associated proteins [BR:mmu03036]
    14252 (Flot2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14252 (Flot2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    14252 (Flot2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    14252 (Flot2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14252 (Flot2)
SSDB
Motif
Pfam: Band_7 Flot
Other DBs
NCBI-GeneID: 14252
NCBI-ProteinID: NP_001035493
MGI: 103309
Ensembl: ENSMUSG00000061981
UniProt: Q60634
Structure
Position
11:77928757..77951260
AA seq 428 aa
MGNCHTVGPNEALVVSGGCCGSDYKQYVFGGWAWAWWCISDTQRISLEIMTLQPRCEDVE
TAEGVALTVTGVAQVKIMTEKELLAVACEQFLGKNVQDIKNVVLQTLEGHLRSILGTLTV
EQIYQDRDQFAKLVREVAAPDVGRMGIEILSFTIKDVYDKVDYLSSLGKTQTAVVQRDAD
IGVAEAERDAGIREAECKKEMLDVKFMADTKIADSKRAFELQKSAFSEEVNIKTAEAQLA
YELQGAREQQKIRQEEIEIEVVQRKKQIAVEAQEILRTDKELIATVRRPAEAEAHRIQQI
AEGEKVKQVLLAQAEAEKIRKIGEAEAAVIEAMGKAEAERMKLKAEAYQKYGDAAKMALV
LEALPQIAAKISAPLTKVDEIVVLSGDNSKVTSEVNRLLAELPASVHALTGVDLSKIPLI
KNATGAQV
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgggcaactgccacacggtgggccccaacgaggcgctggtggtctcaggaggctgttgt
ggttctgactacaaacagtatgtgtttggaggctgggcttgggcctggtggtgtatctcg
gacactcagaggatttccctagagattatgacgttgcagccccgctgtgaggacgtagag
acggccgagggggtagctttaactgtgacgggtgtcgcccaggtgaagatcatgacggag
aaggagctcctggctgtagcctgtgaacagttcctgggcaagaacgtacaggacattaag
aacgtcgtgctgcagaccctggaggggcatctacgctctatcctagggactctgactgta
gaacagatttatcaggaccgagaccagtttgccaagctggtgcgggaagtggcggccccc
gatgttggccgcatgggcatcgagatcctcagcttcaccatcaaggatgtttatgacaaa
gtagactatctgagctccctgggcaagacacagactgctgtggtgcagagagatgcagac
attggtgtggcagaggcagaacgggacgcaggcatccgggaagctgaatgcaagaaggag
atgctagatgtgaagttcatggcagacaccaagatcgctgactctaagagagcctttgag
cttcaaaagtcagccttcagcgaggaagtcaacatcaagacagctgaggcccagttggcc
tatgagctgcaaggggcccgcgagcaacagaagatccggcaggaagagattgagattgag
gtcgtacagcgcaagaagcagatcgccgtggaggcgcaggagatcctccgcaccgacaag
gagctcatcgccaccgtgcgccgccctgcagaggctgaggcccaccgcatccagcagatc
gctgagggcgaaaaggtgaaacaagtcctcttggcacaagcagaagctgagaagattcgc
aaaattggagaggcagaggcagcagtcattgaggcaatgggcaaggccgaggctgagcgg
atgaagcttaaggctgaggcctaccagaagtatggggatgcagccaagatggccttggtg
ctggaggccctgccccagattgctgccaagatctccgcgcccctgactaaagtcgatgag
attgtggttctcagtggggacaacagcaaggtgacatcagaagtaaaccggctgctagca
gaactgccagcctctgtgcacgccctcaccggtgtggacctttcaaagatacccctgatc
aagaacgccactggtgcacaggtgtga

DBGET integrated database retrieval system