KEGG   Mus musculus (mouse): 14255Help
Entry
14255             CDS       T01002                                 

Gene name
Flt3, B230315G04, CD135, Flk-2, Flk2, Flt-3, Ly72, wmfl
Definition
(RefSeq) FMS-like tyrosine kinase 3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04640  Hematopoietic cell lineage
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05221  Acute myeloid leukemia
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14255 (Flt3)
   04010 MAPK signaling pathway
    14255 (Flt3)
   04151 PI3K-Akt signaling pathway
    14255 (Flt3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    14255 (Flt3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14255 (Flt3)
   05202 Transcriptional misregulation in cancer
    14255 (Flt3)
   05230 Central carbon metabolism in cancer
    14255 (Flt3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    14255 (Flt3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14255 (Flt3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    14255 (Flt3)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14255 (Flt3)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   14255 (Flt3)
CD molecules [BR:mmu04090]
 Proteins
  14255 (Flt3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ig Ig_3 I-set Ig_2 APH Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 14255
NCBI-ProteinID: NP_034359
MGI: 95559
Ensembl: ENSMUSG00000042817
Vega: OTTMUSG00000020408
UniProt: Q00342 Q3UEW6 Q3TQF1
Position
5 86.88 cM; 5 G3
AA seq 1000 aa AA seqDB search
MRALAQRSDRRLLLLVVLSVMILETVTNQDLPVIKCVLISHENNGSSAGKPSSYRMVRGS
PEDLQCAPRRQSEGTVYEAATVEVAESGSITLQVQLATPGDLSCLWVFKHSSLGCQPHFD
LQNRGIVSMAILNVTETQAGEYLLHIQSEAANYTVLFTVNVRDTQLYVLRRPYFRKMENQ
DALLCISEGVPEPTVEWVLCSSHRESCKEEGPAVVRKEEKVLHELFGTDIRCCARNALGR
ECTKLFTIDLNQAPQSTLPQLFLKVGEPLWIRCKAIHVNHGFGLTWELEDKALEEGSYFE
MSTYSTNRTMIRILLAFVSSVGRNDTGYYTCSSSKHPSQSALVTILEKGFINATSSQEEY
EIDPYEKFCFSVRFKAYPRIRCTWIFSQASFPCEQRGLEDGYSISKFCDHKNKPGEYIFY
AENDDAQFTKMFTLNIRKKPQVLANASASQASCSSDGYPLPSWTWKKCSDKSPNCTEEIP
EGVWNKKANRKVFGQWVSSSTLNMSEAGKGLLVKCCAYNSMGTSCETIFLNSPGPFPFIQ
DNISFYATIGLCLPFIVVLIVLICHKYKKQFRYESQLQMIQVTGPLDNEYFYVDFRDYEY
DLKWEFPRENLEFGKVLGSGAFGRVMNATAYGISKTGVSIQVAVKMLKEKADSCEKEALM
SELKMMTHLGHHDNIVNLLGACTLSGPVYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFK
EHNFSFYPTFQAHSNSSMPGSREVQLHPPLDQLSGFNGNLIHSEDEIEYENQKRLAEEEE
EDLNVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIL
SDSSYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDAN
FYKLIQSGFKMEQPFYATEGIYFVMQSCWAFDSRKRPSFPNLTSFLGCQLAEAEEAMYQN
MGGNVPEHPSIYQNRRPLSREAGSEPPSPQAQVKIHGERS
NT seq 3003 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcgttggcgcagcgcagcgaccggcggctgctgctgcttgttgttttgtcagta
atgattcttgagaccgttacaaaccaagacctgcctgtgatcaagtgtgttttaatcagt
catgagaacaatggctcatcagcgggaaagccatcatcgtaccgaatggtgcgaggatcc
ccagaagacctccagtgtgccccgaggcgccagagtgaagggacggtatatgaagcggcc
accgtggaggtggccgagtctgggtccatcaccctgcaagtgcagctcgccaccccaggg
gacctttcctgcctctgggtctttaagcacagctccctgggctgccagccgcactttgat
ttacaaaacagaggaatcgtttccatggccatcttgaacgtgacagagacccaggcagga
gaatacctactccatattcagagcgaagccgccaactacacagtactgttcacagtgaat
gtaagagatacacagctgtacgtgctaagaagaccttactttaggaagatggaaaaccag
gacgcactgctctgcatctccgagggtgttccagagcccactgtggagtgggtgctctgc
agctcccacagggaaagctgtaaagaagaaggccctgctgttgtcagaaaggaggaaaag
gtacttcatgagttgttcggaacagacatcagatgctgtgctagaaatgcactgggccgc
gaatgcaccaagctgttcaccatagatctaaaccaggctcctcagagcacactgccccag
ttattcctgaaagtgggggaacccttgtggatcaggtgtaaggccatccatgtgaaccat
ggattcgggctcacctgggagctggaagacaaagccctggaggagggcagctactttgag
atgagtacctactccacaaacaggaccatgattcggattctcttggcctttgtgtcttcc
gtgggaaggaacgacaccggatattacacctgctcttcctcaaagcaccccagccagtca
gcgttggtgaccatcctagaaaaagggtttataaacgctaccagctcgcaagaagagtat
gaaattgacccgtacgaaaagttctgcttctcagtcaggtttaaagcgtacccacgaatc
cgatgcacgtggatcttctctcaagcctcatttccttgtgaacagagaggcctggaggat
gggtacagcatatctaaattttgcgatcataagaacaagccaggagagtacatattctat
gcagaaaatgatgacgcccagttcaccaaaatgttcacgctgaatataagaaagaaacct
caagtgctagcaaatgcctcagccagccaggcgtcctgttcctctgatggctacccgcta
ccctcttggacctggaagaagtgttcggacaaatctcccaattgcacggaggaaatccca
gaaggagtttggaataaaaaggctaacagaaaagtgtttggccagtgggtgtcgagcagt
actctaaatatgagtgaggccgggaaagggcttctggtcaaatgctgtgcgtacaattct
atgggcacgtcttgcgaaaccatctttttaaactcaccaggccccttccctttcatccaa
gacaacatctccttctatgcgaccattgggctctgtctccccttcattgttgttctcatt
gtgttgatctgccacaaatacaaaaagcaatttaggtacgagagtcagctgcagatgatc
caggtgactggccccctggataacgagtacttctacgttgacttcagggactatgaatat
gaccttaagtgggagttcccgagagagaacttagagtttgggaaggtcctggggtctggc
gctttcgggagggtgatgaacgccacggcctatggcattagtaaaacgggagtctcaatt
caggtggcggtgaagatgctaaaagagaaagctgacagctgtgaaaaagaagctctcatg
tcggagctcaaaatgatgacccacctgggacaccatgacaacatcgtgaatctgctgggg
gcatgcacactgtcagggccagtgtacttgatttttgaatattgttgctatggtgacctc
ctcaactacctaagaagtaaaagagagaagtttcacaggacatggacagagatttttaag
gaacataatttcagtttttaccctactttccaggcacattcaaattccagcatgcctggt
tcacgagaagttcagttacacccgcccttggatcagctctcagggttcaatgggaattta
attcattctgaagatgagattgaatatgaaaaccagaagaggctggcagaagaagaggag
gaagatttgaacgtgctgacgtttgaagacctcctttgctttgcgtaccaagtggccaaa
ggcatggaattcctggagttcaagtcgtgtgtccacagagacctggcagccaggaatgtg
ttggtcacccacgggaaggtggtgaagatctgtgactttggactggcccgagacatcctg
agcgactccagctacgtcgtcaggggcaacgcacggctgccggtgaagtggatggcacct
gagagcttatttgaagggatctacacaatcaagagtgacgtctggtcctacggcatcctt
ctctgggagatattttcactgggtgtgaacccttaccctggcattcctgtcgacgctaac
ttctataaactgattcagagtggatttaaaatggagcagccattctatgccacagaaggg
atatactttgtaatgcaatcctgctgggcttttgactcaaggaagcggccatccttcccc
aacctgacttcatttttaggatgtcagctggcagaggcagaagaagcgatgtatcagaac
atgggtggcaacgtcccagaacatccatccatctaccaaaacaggcggcccctcagcaga
gaggcaggctcagagccgccatcgccacaggcccaggtgaagattcacggagaaagaagt
tag

DBGET integrated database retrieval system