KEGG   Mus musculus (mouse): 14257Help
Entry
14257             CDS       T01002                                 

Gene name
Flt4, AI323512, Chy, Flt-4, VEGFR-3, VEGFR3
Definition
(RefSeq) FMS-like tyrosine kinase 4
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14257 (Flt4)
   04015 Rap1 signaling pathway
    14257 (Flt4)
   04010 MAPK signaling pathway
    14257 (Flt4)
   04151 PI3K-Akt signaling pathway
    14257 (Flt4)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    14257 (Flt4)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14257 (Flt4)
   05224 Breast cancer
    14257 (Flt4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14257 (Flt4)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   14257 (Flt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ig_3 I-set Pkinase Ig_2 ig V-set C1-set Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 14257
NCBI-ProteinID: NP_032055
MGI: 95561
Ensembl: ENSMUSG00000020357
Vega: OTTMUSG00000005554
UniProt: P35917 Q5SU94
Position
11 B1.2; 11 29.69 cM
AA seq 1363 aa AA seqDB search
MQPGAALNLRLWLCLGLLQGLANGYSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWT
WPGAQEVLTTGGKDSEDTRVVHDCEGTEARPYCKVLLLAQTHANNTGSYHCYYKYIKARI
EGTTAASTYVFVRDFKHPFINKPDTLLVNRKDSMWVPCLVSIPGLNITLRSQSSALHPDG
QEVLWDDRRGMRVPTQLLRDALYLQCETTWGDQNFLSNLFVVHITGNELYDIQLYPKKSM
ELLVGEKLVLNCTVWAEFDSGVTFDWDYPGKQAERAKWVPERRSQQTHTELSSILTIHNV
SQNDLGPYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLAA
YPPPEFQWYKDRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNV
PPHIHEKEASSPSIYSRHSRQTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSLRRRQQR
DGMPQCRDWKEVTTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQDANVSAMYKCVVVNKV
GQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHD
AQGNPLLLDCKNVHLFATPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRS
QDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEK
ESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILI
GTGVIAVFFWVLLLLIFCNMKRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRVKRDTFNPYAEKSPEQRRRF
RAMVEGAKADRRRPGSSDRALFTRFLMGKGSARRAPLVQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDIVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKDGTRMRAPELA
TPAIRHIMQSCWSGDPKARPAFSDLVEILGDLLQGGGWQEEEEERMALHSSQSSEEDGFM
QASTTALHITEADADDSPPSMHCHSLAARYYNCVSFPGRLARGTKTPGSSRMKTFEELPM
TPTTYKASMDNQTDSGMVLASEEFEELESRHRPEGSFSCKGPGQHMDIPRGHPDPQGRRR
RPTQGAQGGKVFYNNEYGEVSQPCTEGDCCPSAGSTFFADSSY
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgggcgctgcgctgaacctgcgcctgtggctctgcctcggactcctccaaggc
ctggcaaatggttactccatgacccctccaaccctgaacatcacagaggattcatatgtg
attgacaccggggacagcctatccatatcctgcaggggacagcaccccctcgagtggacc
tggccaggggcccaggaggtactgaccacaggtgggaaggacagtgaagacacacgggtt
gtgcatgactgtgaaggcacagaagctaggccctactgcaaggtgctactgctggcccag
actcacgccaacaacacgggcagctaccactgctactacaagtacatcaaggcccggatt
gagggcaccacagctgccagcacctatgtgtttgtaagagactttaaacaccctttcatc
aacaaacctgacacgctcctggtcaacaggaaggactcgatgtgggtgccctgcttggtg
tccattcccggcctcaacatcacactgcgctcgcaaagctcagcgctgcaccccgacggg
caggaggtgctgtgggatgaccgccggggcatgcgggtgcccactcaactgttgcgcgat
gccctgtacctgcagtgcgagaccacctggggtgaccagaacttcctttccaatctcttc
gtcgtgcacatcacaggcaatgagctctatgacatccagctgtaccccaagaagtcaatg
gagctgttggttggagagaagctggttttgaactgtacagtgtgggctgagttcgactca
ggtgtcaccttcgactgggattatccagggaagcaggcagagcgggctaagtgggtacct
gagcggcgttcccagcagacccacacagaactctccagcatcctgaccatccacaatgtc
agccagaatgacctgggcccctatgtgtgtgaggccaacaatgggattcagcggttccgg
gaaagcacagaggtcattgtgcacgaaaagcccttcatcagtgtcgagtggctcaaagga
cctgtcctggaggccacagccggtgacgagctggtgaagctacccgtgaagctggcagct
tatcccccaccggagttccaatggtacaaggacagaaaggcagtgactgggcgccacaat
ccccatgctctggtgctcaaagaggtgaccgaggccagcgcaggggtctacactctcgcc
ctgtggaactctgcagctggtctgaggcaaaacatcagtctggagctggtggtgaatgtg
cctcctcacatccacgaaaaggaagcctcttcacccagcatctactcccgccacagtcgc
cagaccctcacctgcaccgcctatggagtaccccaacccctcagtgtccagtggcactgg
aggccctggacaccctgcaagacgtttgcccagcgcagcctccggaggcggcagcagcgg
gatggcatgccacagtgccgagactggaaggaggtgaccactcaggatgctgtgaacccc
atcgagagtctggacagctggacggagtttgtggaggggaagaataagacggtgagcaag
ctggtgatccaggatgccaatgtgtcagccatgtacaagtgtgtggtcgtcaacaaagtg
ggccaggatgagagactcatctacttctatgtgaccaccatcccggacggtttcagtatc
gagtcggagccttctgaggatcccttagaaggccagtccgtgcgcctcagctgccgggcg
gacaactacacgtacgaacatctgcgctggtaccggctcaacctctccacactgcacgat
gctcaagggaaccccctattgctggactgcaaaaacgtgcacctgtttgccacgccccta
gaggccaacctagaggaggcagagcccggggcccgccacgccaccctcagtttgaatatc
ccccgagtggcgcccgaggacgagggtgactacgtgtgtgaagtgcaggataggcgcagc
caggacaagcactgccacaagaagtacctgtccgtgcaggccctggaagctcctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagtgactccctggagatgcgatgcccg
gtggctggagcgcatgtgcccagtattgtgtggtacaaagatgaaaggctcctggagaaa
gagtcgggaatcgacctggcagactccaatcagaggctgagcatccagcgcgtgcgcgag
gaggacgcaggtcgttatctgtgcagcgtgtgcaatgccaagggctgcgtaaactcctct
gccagcgtggcagtggaaggctctgaagataaaggcagcatggagattgtgatactcatt
ggcactggcgtcatcgcagttttcttctgggtcctcctcctgctcatcttctgtaacatg
aaaaggcctgcccatgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctttggaggagcagtgtgaatacctgtcctatgacgccagccagtgggagttc
cccagggaaaggttgcacctcgggagagtcctaggccacggggcttttgggaaggtggtg
gaagcctcagcttttggcatcaataaaggcagcagctgtgacaccgtggctgtgaagatg
ctgaaagagggcgctactgccagcgagcaccgtgccctgatgtcggagctcaagatccta
attcacatcggcaaccatctcaacgtggtcaacctcctaggggcgtgcaccaagcccaac
ggccctctcatggtgatcgtggagttttgcaaatacggcaacctctccaacttcttgcgt
gtcaagcgggacacgttcaacccctacgcggagaagtctccggagcaacgcaggcgcttc
cgcgccatggtagaaggcgccaaagctgataggaggagacctggaagcagcgacagggcc
ctgttcacgcggttcctgatgggcaaaggaagtgcacggcgagccccacttgtccaagaa
gctgaggacctatggctgagcccactgaccatggaagaccttgtatgctacagcttccaa
gttgcccggggaatggagttcctggcttcccgcaagtgcattcacagagacctggctgct
cggaacatcctactgtcagaaagtgacatagtgaagatctgcgactttggcctcgctcgg
gacatctacaaagaccccgactatgtccgaaagggcagtgcccgacttcctctgaaatgg
atggcccccgagagcatctttgataaggtgtacaccacgcagagtgatgtgtggtccttc
ggcgtgctgctgtgggagatcttctcattgggggcctctccataccctggggtacagatc
aatgaggagttctgccagcggctgaaggatggcactcgaatgagagccccggaactggcc
actcctgccatacgccacatcatgcagagttgctggtctggagaccctaaagcaagacct
gctttctctgacctagtggagatcctgggggacctgcttcagggcggaggctggcaggag
gaggaagaggagcgcatggccctgcacagctctcagagctccgaggaggatggcttcatg
caggcatccaccacagctctacatatcaccgaagcagacgctgatgatagtccacccagc
atgcattgccacagcctggcagccagatattacaactgtgtgtcctttcctgggcgcctg
gccagaggcactaagactccaggctcttccaggatgaagacatttgaagaattgcccatg
acccctacaacctacaaagcctccatggataaccagacagacagcgggatggtgctggcc
tcagaagagtttgaggagctagaaagcaggcatagaccagaaggcagcttcagctgtaaa
ggtcctggccagcacatggatattcccagaggacaccctgacccccaggggaggcggcga
cggcccactcaaggggcacaaggaggcaaggtgttttataacaacgagtatggggaggtc
tcccagccatgtacagaaggtgactgctgcccgtctgctggctccaccttcttcgcagac
agcagctactaa

DBGET integrated database retrieval system