KEGG   Mus musculus (mouse): 14257
Entry
14257             CDS       T01002                                 

Gene name
Flt4, AI323512, Chy, Flt-, Flt-4, VEGF, VEGFR, VEGFR-3, VEGFR3
Definition
(RefSeq) FMS-like tyrosine kinase 4
  KO
K05097  FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04020  Calcium signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04510  Focal adhesion
mmu05200  Pathways in cancer
mmu05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14257 (Flt4)
   04014 Ras signaling pathway
    14257 (Flt4)
   04015 Rap1 signaling pathway
    14257 (Flt4)
   04020 Calcium signaling pathway
    14257 (Flt4)
   04151 PI3K-Akt signaling pathway
    14257 (Flt4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14257 (Flt4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14257 (Flt4)
  09162 Cancer: specific types
   05224 Breast cancer
    14257 (Flt4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14257 (Flt4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14257 (Flt4)
Protein kinases [BR:mmu01001]
 Receptor tyrosine kinases (RTK)
  VEGFR family [OT]
   14257 (Flt4)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Ig_3 I-set Pkinase Ig_2 ig VEGFR-2_TMD V-set C1-set TCAD9 Haspin_kinase
Other DBs
NCBI-GeneID: 14257
NCBI-ProteinID: NP_032055
MGI: 95561
Ensembl: ENSMUSG00000020357
Vega: OTTMUSG00000005554
UniProt: P35917 Q5SU94
Position
11 B1.2; 11 29.69 cM
AA seq 1363 aa
MQPGAALNLRLWLCLGLLQGLANGYSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWT
WPGAQEVLTTGGKDSEDTRVVHDCEGTEARPYCKVLLLAQTHANNTGSYHCYYKYIKARI
EGTTAASTYVFVRDFKHPFINKPDTLLVNRKDSMWVPCLVSIPGLNITLRSQSSALHPDG
QEVLWDDRRGMRVPTQLLRDALYLQCETTWGDQNFLSNLFVVHITGNELYDIQLYPKKSM
ELLVGEKLVLNCTVWAEFDSGVTFDWDYPGKQAERAKWVPERRSQQTHTELSSILTIHNV
SQNDLGPYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLAA
YPPPEFQWYKDRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNV
PPHIHEKEASSPSIYSRHSRQTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSLRRRQQR
DGMPQCRDWKEVTTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQDANVSAMYKCVVVNKV
GQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHD
AQGNPLLLDCKNVHLFATPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRS
QDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEK
ESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILI
GTGVIAVFFWVLLLLIFCNMKRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRVKRDTFNPYAEKSPEQRRRF
RAMVEGAKADRRRPGSSDRALFTRFLMGKGSARRAPLVQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDIVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKDGTRMRAPELA
TPAIRHIMQSCWSGDPKARPAFSDLVEILGDLLQGGGWQEEEEERMALHSSQSSEEDGFM
QASTTALHITEADADDSPPSMHCHSLAARYYNCVSFPGRLARGTKTPGSSRMKTFEELPM
TPTTYKASMDNQTDSGMVLASEEFEELESRHRPEGSFSCKGPGQHMDIPRGHPDPQGRRR
RPTQGAQGGKVFYNNEYGEVSQPCTEGDCCPSAGSTFFADSSY
NT seq 4092 nt   +upstreamnt  +downstreamnt
atgcagccgggcgctgcgctgaacctgcgcctgtggctctgcctcggactcctccaaggc
ctggcaaatggttactccatgacccctccaaccctgaacatcacagaggattcatatgtg
attgacaccggggacagcctatccatatcctgcaggggacagcaccccctcgagtggacc
tggccaggggcccaggaggtactgaccacaggtgggaaggacagtgaagacacacgggtt
gtgcatgactgtgaaggcacagaagctaggccctactgcaaggtgctactgctggcccag
actcacgccaacaacacgggcagctaccactgctactacaagtacatcaaggcccggatt
gagggcaccacagctgccagcacctatgtgtttgtaagagactttaaacaccctttcatc
aacaaacctgacacgctcctggtcaacaggaaggactcgatgtgggtgccctgcttggtg
tccattcccggcctcaacatcacactgcgctcgcaaagctcagcgctgcaccccgacggg
caggaggtgctgtgggatgaccgccggggcatgcgggtgcccactcaactgttgcgcgat
gccctgtacctgcagtgcgagaccacctggggtgaccagaacttcctttccaatctcttc
gtcgtgcacatcacaggcaatgagctctatgacatccagctgtaccccaagaagtcaatg
gagctgttggttggagagaagctggttttgaactgtacagtgtgggctgagttcgactca
ggtgtcaccttcgactgggattatccagggaagcaggcagagcgggctaagtgggtacct
gagcggcgttcccagcagacccacacagaactctccagcatcctgaccatccacaatgtc
agccagaatgacctgggcccctatgtgtgtgaggccaacaatgggattcagcggttccgg
gaaagcacagaggtcattgtgcacgaaaagcccttcatcagtgtcgagtggctcaaagga
cctgtcctggaggccacagccggtgacgagctggtgaagctacccgtgaagctggcagct
tatcccccaccggagttccaatggtacaaggacagaaaggcagtgactgggcgccacaat
ccccatgctctggtgctcaaagaggtgaccgaggccagcgcaggggtctacactctcgcc
ctgtggaactctgcagctggtctgaggcaaaacatcagtctggagctggtggtgaatgtg
cctcctcacatccacgaaaaggaagcctcttcacccagcatctactcccgccacagtcgc
cagaccctcacctgcaccgcctatggagtaccccaacccctcagtgtccagtggcactgg
aggccctggacaccctgcaagacgtttgcccagcgcagcctccggaggcggcagcagcgg
gatggcatgccacagtgccgagactggaaggaggtgaccactcaggatgctgtgaacccc
atcgagagtctggacagctggacggagtttgtggaggggaagaataagacggtgagcaag
ctggtgatccaggatgccaatgtgtcagccatgtacaagtgtgtggtcgtcaacaaagtg
ggccaggatgagagactcatctacttctatgtgaccaccatcccggacggtttcagtatc
gagtcggagccttctgaggatcccttagaaggccagtccgtgcgcctcagctgccgggcg
gacaactacacgtacgaacatctgcgctggtaccggctcaacctctccacactgcacgat
gctcaagggaaccccctattgctggactgcaaaaacgtgcacctgtttgccacgccccta
gaggccaacctagaggaggcagagcccggggcccgccacgccaccctcagtttgaatatc
ccccgagtggcgcccgaggacgagggtgactacgtgtgtgaagtgcaggataggcgcagc
caggacaagcactgccacaagaagtacctgtccgtgcaggccctggaagctcctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagtgactccctggagatgcgatgcccg
gtggctggagcgcatgtgcccagtattgtgtggtacaaagatgaaaggctcctggagaaa
gagtcgggaatcgacctggcagactccaatcagaggctgagcatccagcgcgtgcgcgag
gaggacgcaggtcgttatctgtgcagcgtgtgcaatgccaagggctgcgtaaactcctct
gccagcgtggcagtggaaggctctgaagataaaggcagcatggagattgtgatactcatt
ggcactggcgtcatcgcagttttcttctgggtcctcctcctgctcatcttctgtaacatg
aaaaggcctgcccatgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctttggaggagcagtgtgaatacctgtcctatgacgccagccagtgggagttc
cccagggaaaggttgcacctcgggagagtcctaggccacggggcttttgggaaggtggtg
gaagcctcagcttttggcatcaataaaggcagcagctgtgacaccgtggctgtgaagatg
ctgaaagagggcgctactgccagcgagcaccgtgccctgatgtcggagctcaagatccta
attcacatcggcaaccatctcaacgtggtcaacctcctaggggcgtgcaccaagcccaac
ggccctctcatggtgatcgtggagttttgcaaatacggcaacctctccaacttcttgcgt
gtcaagcgggacacgttcaacccctacgcggagaagtctccggagcaacgcaggcgcttc
cgcgccatggtagaaggcgccaaagctgataggaggagacctggaagcagcgacagggcc
ctgttcacgcggttcctgatgggcaaaggaagtgcacggcgagccccacttgtccaagaa
gctgaggacctatggctgagcccactgaccatggaagaccttgtatgctacagcttccaa
gttgcccggggaatggagttcctggcttcccgcaagtgcattcacagagacctggctgct
cggaacatcctactgtcagaaagtgacatagtgaagatctgcgactttggcctcgctcgg
gacatctacaaagaccccgactatgtccgaaagggcagtgcccgacttcctctgaaatgg
atggcccccgagagcatctttgataaggtgtacaccacgcagagtgatgtgtggtccttc
ggcgtgctgctgtgggagatcttctcattgggggcctctccataccctggggtacagatc
aatgaggagttctgccagcggctgaaggatggcactcgaatgagagccccggaactggcc
actcctgccatacgccacatcatgcagagttgctggtctggagaccctaaagcaagacct
gctttctctgacctagtggagatcctgggggacctgcttcagggcggaggctggcaggag
gaggaagaggagcgcatggccctgcacagctctcagagctccgaggaggatggcttcatg
caggcatccaccacagctctacatatcaccgaagcagacgctgatgatagtccacccagc
atgcattgccacagcctggcagccagatattacaactgtgtgtcctttcctgggcgcctg
gccagaggcactaagactccaggctcttccaggatgaagacatttgaagaattgcccatg
acccctacaacctacaaagcctccatggataaccagacagacagcgggatggtgctggcc
tcagaagagtttgaggagctagaaagcaggcatagaccagaaggcagcttcagctgtaaa
ggtcctggccagcacatggatattcccagaggacaccctgacccccaggggaggcggcga
cggcccactcaaggggcacaaggaggcaaggtgttttataacaacgagtatggggaggtc
tcccagccatgtacagaaggtgactgctgcccgtctgctggctccaccttcttcgcagac
agcagctactaa

DBGET integrated database retrieval system