KEGG   Mus musculus (house mouse): 14264
Entry
14264             CDS       T01002                                 
Symbol
Fmod, FM, SLRR2E
Name
(RefSeq) fibromodulin
  KO
K08121  fibromodulin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    14264 (Fmod)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:mmu00535]
    14264 (Fmod)
Proteoglycans [BR:mmu00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    14264 (Fmod)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_1 LRRNT LRR_9 LRR_6
Other DBs
NCBI-GeneID: 14264
NCBI-ProteinID: NP_067330
MGI: 1328364
Ensembl: ENSMUSG00000041559
UniProt: P50608 Q543D2
Position
1:133964992..133976018
AA seq 376 aa
MQWASVLLLAGLCSLSQGQYDEDSHWWIQYLRNQQSTYYDPYDPYPYEPSEPYPYGVEEG
PAYAYGAPPPPEPRDCPQECDCPPNFPTAMYCDNRNLKYLPFVPSRMKYVYFQNNQISAI
QEGVFDNATGLLWVALHGNQITSDKVGRKVFSKLRHLERLYLDHNNLTRMPGPLPRSLRE
LHLDHNQISRVPNNALEGLENLTALYLHHNEIQEVGSSMRGLRSLILLDLSYNHLRRVPD
GLPSALEQLYLEHNNVYTVPDSYFRGSPKLLYVRLSHNSLTNNGLATNTFNSSSLLELDL
SYNQLQKIPPVNTNLENLYLQGNRINEFSISSFCTVVDVMNFSKLQVLRLDGNEIKRSAM
PVDAPLCLRLANLIEI
NT seq 1131 nt   +upstreamnt  +downstreamnt
atgcagtgggcctccgtcctgctgctggctgggctctgctcactttcccagggccagtat
gatgaagactctcactggtggatccaatacctccgaaaccagcagtccacctactacgac
ccctatgacccttacccctatgagccctctgagccttacccctatggagtggaagaaggc
ccagcctatgcctatggtgcaccacctccaccagagccccgtgattgtccccaagaatgc
gactgtccccccaacttccccacagccatgtactgtgacaaccgcaacctcaagtacctg
ccttttgtgccctcccgcatgaagtacgtctacttccagaacaaccagatctctgccatc
caggaaggtgtctttgacaatgccactgggctcctctgggtcgctctacatggcaaccag
attaccagtgacaaggtaggcaggaaagtcttctccaagctgaggcacttggagaggctg
tacttggaccacaacaacctgacccggatgcccggcccgctgccccgatccctgagagag
ctccacctggaccacaaccagatctcacgggtccccaacaatgctttggagggcctggag
aacctcacggccttatatctccaccacaatgagatccaggaagtggggagttccatgaga
ggcctccggtccctgatcctactagacctgagttataaccaccttcggagggtacccgac
ggtctgccctcagccctggagcagctgtacctagaacacaacaatgtctacaccgtccct
gacagctacttccgggggtcacccaagctgctgtacgtccggttgtctcacaacagtctc
actaacaacggccttgctaccaacaccttcaactccagcagccttcttgagctagacttg
tcttacaatcagctgcagaagatccctcctgtcaacaccaacctggagaatctttacctc
cagggcaacaggatcaatgagttctccatcagcagcttctgcacggtggtggacgtcatg
aacttctccaagctgcaggtgctacgcctggatgggaacgagatcaagcgcagcgcaatg
ccggtggacgccccactctgcctgcgcctcgccaacctcatcgagatctga

DBGET integrated database retrieval system