KEGG   Mus musculus (mouse): 14266
Entry
14266             CDS       T01002                                 

Gene name
Aff2, FMR2P, Fmr2, Ox19, Oxh
Definition
(RefSeq) AF4/FMR2 family, member 2
  KO
K15194  AF4/FMR2 family member 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    14266 (Aff2)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     14266 (Aff2)
SSDB
Motif
Pfam: AF-4 AF-4_C AF4_int
Other DBs
NCBI-GeneID: 14266
NCBI-ProteinID: NP_032058
MGI: 1202294
Ensembl: ENSMUSG00000031189
Vega: OTTMUSG00000017765
UniProt: O55112
Position
X; X A7.1-A7.2
AA seq 1272 aa
MDLFDFFRDWDLEQQCHYEQDRSALKKREWERRNQEVQQEEDLFSSGFDLFGEPYKVAEY
TNKGDALANRVQNTLGSYDEMKDLLSNHSSQNHLVGIPKNSAPQTPISKSEASFYPEQKN
RMIPSHQETTHSSTPMPPPSVVILNSTLIHSNRKSKSEWPRDSHNTSPAQASQTSSQPNK
MQTSTQDPPQTRLEDFFVYPAEQPQIGTVEKSNPSSKEENNPNSGGEDTFKEIFQSNSPE
ESEFTVQAPGSPLVASSLLAPSSGLSVPTFPPGLYCKTSMGQQKPTAYVRPMDGQDQATD
ISPTLKPSIEFENSFGNLSFGSLLDGKPSAVSSKTKLPKFTILQTSEVSLTSDPSCVEEI
LRESQHLTPGFTLQKWSDPSSRASTKMLEDDLKLSSDEDDLEPVKTLTTQCTANELYQAV
EKAKPKNNPVNPLLATPQSTPATQTNVGSGSSSESESSSESDSDTESSTTDSESNEAPRV
ATPEPEPPSTNKWQLDKWLNKVTSQNKSFICGQNETPTETISLPPPIIQPVEVQVKVKPN
PSQAVAVPKERPLLSLIREKARPRPTQKTPETKALKHKLSTSVDTVSQRTIGKKQPKKVE
KNTSFEEFTWPKPNITNSTPKEKGSVELPDPPRSRNKATAHKPVPRKEPRPHVPLATEKK
KYRGPGKIVPKSREFIETDSSTSDSNTDQEETLQIKVLPPCITSKSKETSNASLTLSTLT
NGNSNNLSTSNEETAFSPPPAMQTELLSPLRDHENPKNLWVKIDLDLLSRVPGQNSVPVT
PAKTDYKETASKPKRQTAATAVEKPAPKGKRKHKPAETAEKIPEKKQRLEDNTTICLLPP
CISPAPPHKPPSTRENSSRRANRKKEEKLFPPALSPLAEDPPRRRNVSGNNGHFGQDKNI
SMAGQITSSKPKRSEGKFCATFKGISINEGDAPKKAASATVTVANMALATATATATVPAI
VTATVTATATTTATATTTTTTTTISSITPTITSGLMDSSHLEMTSWAALPLLSSSSANVR
RPKLTFDDSVHNADFYMQEAKKLKHKADALFEKFGKAVNYADAALSFTECGNAMERDPLE
AKSPYTMYSETVELLRYAMRLKNFASPLASDGDKKLAVLCYRCLSLLYLRMFKLKKDHAM
KYSRSLMEYFKQNASKVTQIPSPWVGNGKNTPSPVSLNNVSPINSVGNCNNGPVTIPQRI
HHMAASHVNITSNVLRGYEHWDMADKLTRDNKEFFGDLDTLMGPLTQHSSMTNLVRYVRQ
GLCWLRIDAHLL
NT seq 3819 nt   +upstreamnt  +downstreamnt
atggatctattcgactttttcagggattgggacttggagcagcagtgtcactatgaacaa
gaccgtagtgcacttaaaaaaagggaatgggaacgaaggaatcaagaagttcagcaagaa
gaagatctcttttcttcaggctttgatctttttggggagccctacaaggtagctgaatat
acaaacaaaggggatgcccttgccaaccgagtccagaacactcttggaagttatgatgaa
atgaaggatctgctatctaaccattccagtcagaatcatctggtgggcattccaaagaat
tctgcaccccaaactcccatcagcaaaagtgaagcaagcttttatccagaacaaaaaaat
cgaatgatcccatctcaccaggagactacccactcctcaacaccgatgcctccaccttca
gtcgtgatactgaattccactctaatacacagcaacagaaaatcaaaatctgagtggcca
cgagatagtcataacactagccctgcacaagcaagccagaccagcagtcaaccaaacaag
atgcagacatccacacaagacccacctcaaaccagactggaagacttctttgtctaccct
gctgagcaaccccaaattggtacagttgaaaaatctaacccatcttcaaaggaagaaaat
aaccctaattcaggtggagaagatactttcaaagaaatttttcagtctaattcaccagaa
gaatctgaatttacagtgcaagcacctgggtctcccctagttgcctcatctttattagct
cccagcagtggcctttcagttccaacattcccaccagggctttactgcaaaacaagcatg
ggacaacaaaaaccaactgcatatgtaaggcccatggatgggcaggaccaggcaactgac
atctctccaacactgaagccttccattgaatttgagaacagttttggaaacctctccttt
ggatcactattggatgggaaacccagtgcagtcagttcaaagactaaactgccaaagttc
acaatcctgcaaacaagtgaagtaagccttaccagtgatccaagctgtgttgaagaaatc
ttgcgggaatctcagcatctgactccaggatttaccttacaaaagtggagcgacccaagc
agcagagcttccacaaagatgcttgaggatgacttgaagctgagcagtgatgaagatgac
cttgagcctgtgaagaccttgaccacacagtgcacagccaacgagctttaccaggctgtt
gaaaaggcaaaacctaagaataatcctgtgaacccactcttggccacaccacagtctacg
cctgcaacacaaaccaatgtggggtctggcagctccagtgagtcagagagtagctcagaa
tcggactcagacactgaaagcagcaccactgacagcgaatccaatgaggctcctagagtg
gctactccagagcctgagccaccctcaaccaacaaatggcagctagacaaatggctgaac
aaagtcacgtcccagaacaagtcatttatttgtggccaaaatgagacacccacagagacc
atttctctgcctcctccaataatacaaccggtggaggtccaggtcaaagtgaaaccaaac
cctagccaggctgtggctgtacccaaagaaaggcctctccttagtcttattagggaaaaa
gctcgaccaaggcccacacagaaaactccagaaacaaaggccttgaagcataagctgtca
acatcagttgacacagtttctcaaaggacaattggaaagaaacagcccaaaaaagttgag
aaaaacaccagctttgaggagtttacctggcccaaaccaaatattaccaacagcactccc
aaagaaaaaggaagtgtagagcttcctgacccaccacgaagccgaaacaaagctactgcc
cacaaaccagtgcctaggaaagagccaaggcctcatgtccctctggccactgagaagaag
aagtatagagggcctgggaagattgtccccaagtcccgggaatttattgaaacagattca
tctacatctgactccaacacagaccaggaagagaccctacagatcaaagtactgccacct
tgcattacttctaaatccaaggaaacttctaatgccagcctgacacttagcaccttgacc
aatggcaacagcaacaacttatccaccagcaatgaggagacagctttttccccgcctcct
gccatgcaaactgagcttttgtcccctctacgggatcatgaaaatccaaaaaacctctgg
gtgaagattgacctcgacttactttctagagtacctggccaaaattcagtcccagtaaca
cctgcaaagacagactacaaggagactgcctctaaacccaagcgtcaaactgctgccaca
gctgtggaaaaaccagcccctaagggcaaacgtaagcacaagccagcagaaactgcagag
aaaatccctgagaagaagcagcgcctggaggacaacactactatctgcctgcttccccct
tgcatctcaccagccccgccccacaagcctcccagcactagagaaaattcatccaggaga
gcaaacaggaaaaaagaagaaaagctgttccctcctgcactttccccactggcagaggat
cctccacgtcgcagaaatgtcagtggcaacaatgggcatttcggtcaggacaaaaacatt
tccatggctggacaaatcacctctagcaaacctaaaagaagtgaaggcaaattctgtgct
actttcaaggggatatctataaatgagggagatgctccaaaaaaggctgcctctgccacc
gttactgtcgccaatatggctcttgccactgctactgccactgccactgttcctgccatt
gtcactgccactgtcacagctactgccaccaccactgctacagccactaccacaaccact
accactactatttctagcatcacccctacaatcacttctggccttatggatagcagtcac
ctggagatgacatcctgggcagccctgccccttctgtccagcagtagtgccaatgtccgg
agacccaagctcacatttgatgactctgttcacaatgctgatttttacatgcaagaggct
aagaagctgaaacacaaagctgatgcactgtttgagaaatttggcaaagctgtgaattat
gcagatgcagccttgtccttcactgaatgtggcaatgccatggaacgtgatcctctggaa
gcgaagtccccatataccatgtattctgagactgtggagctcctcaggtatgcaatgaga
ctgaagaactttgcaagccccttggcttctgatggggataaaaagctagccgtattatgc
taccgatgcttgtcacttctctatttgaggatgtttaaactgaagaaggaccatgctatg
aagtactccagatcactgatggaatattttaagcaaaatgcttcaaaagttactcagata
ccatctccttgggtaggcaatggaaagaatactccatccccagtgtctctcaacaatgtc
tctcccatcaactcagtggggaattgtaacaatggccctgtcacaattccccagcgcatc
caccatatggctgctagccatgtgaatattaccagtaatgtgcttcggggctatgaacac
tgggatatggctgacaaactgacaagagacaataaagaattctttggtgatctggataca
ctgatggggcctctgacccagcacagcagcatgaccaatcttgtccgctatgttcgccag
ggactgtgttggctacgcatcgatgctcatttgttgtag

DBGET integrated database retrieval system