KEGG   Mus musculus (house mouse): 142682
Entry
142682            CDS       T01002                                 
Symbol
Zcchc14, AA792890, BDG29
Name
(RefSeq) zinc finger, CCHC domain containing 14
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: zf-CCHC SAM_1 DUF4719 SAM_2
Other DBs
NCBI-GeneID: 142682
NCBI-ProteinID: NP_543131
MGI: 2159407
Ensembl: ENSMUSG00000061410
UniProt: Q8VIG0 A2RTC2
Position
8:complement(122325434..122379662)
AA seq 1093 aa
MVEKRCPLQRDGVYRWFSELPSPQRVEFLCGLLDLCIPLELRFLGSCLEDLARKDYHSLR
DSEIKANNPADLGSLTNLTDEVVRSKLLVSLALLGSEQREAAGVLYRTLTHTDSIIHNYG
LQLNEGRTGDEFLLLFTMASNHPAFSFHQKQVLRQELTQIQSSLNSGGGGGGGGGGGGKS
APGPSGALPTCSACHKMAPRTETPVSSISNSLENALHTSAHSTEESLPKRPLGKHGKVSV
EKIDLKGLSHTKNDRSVECSFEVLWSDSSITSVTKSSSEVTEFISKLSQLCPEENLDKLI
PCLAGPDSFYVERNHVDLEAGLRFLASAPSHTLKHDHVRKFFSSSSPSQQLQSPSPGNPS
LPKVGAVMGVSGRPVCGVAGIPSSQSSAQHHLQHSASTSASLPHCSHTGGTGSALAYRTQ
VDNSPTILMPSSLQTPQPQEQNGILDWLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFE
SLTMGAKKKLKTQLELEKEKSERRCLNSSAPSLVTSSGVARVTPTSHVGPVQPGRSSSHA
SELRVEVEPPAHQLPREGSSSEYSSSSSSPMGVQVREESSDSAEESDRRVDIHVEGTEKE
KPVMLLAHFPSSSARPTAQVLPVQNETGSSPAAHHPLPPQLMPAASHLAPVRMLNSVHKS
DRGGADVKLLSSSVHSLLSLEERNKGPGPRSGTKVDKSFGGAVLDPLPSAAPHPPGQGLS
GLVENNAVSPTVSFGPRAKVVHAATLDRVLKTAQQPALTVESSSATTGTPSTVLHVARPP
IKLLLASSVPADAAIAGQTSCPNNGQISVPPAIMNPRTALYTANTKVAFSAVSSVPVGPL
QGSFCANSNTASPSSHPSTSFASMASLPSCPAPSSSPALSSVPESSFYSGGAGSSSPGNI
PASSQSHHHHHHHQQPPAPPQPAPPPPGCIVCTSCGCSGSCGSNGLTVSYANYFQHPFSG
PSVLTFPFLPFSPMCGNGYVSTQQYGGGSAFPVVHTPYNGSVTPDPVLGGQSTFAVPPMQ
NFMAGTAGVYQAQGLVGSTNGSSHKKSGNLSCYNCGATGHRAQDCKQPSMDFNRQGTFRL
KYAPPAESLDSTD
NT seq 3282 nt   +upstreamnt  +downstreamnt
atggtggagaagcgttgcccgttgcagagggacggcgtgtaccgctggttctctgaactg
ccgtcgccgcagcgtgtggagttcctgtgcggcctgctggacctgtgcatcccgctcgag
ttgcgcttcctcggctcgtgcctggaggacttggcacgcaaggactaccattcgctgcgc
gactcggagatcaaggccaacaacccggccgacctgggcagcctcaccaacctgacggac
gaggtggtgcgcagcaagctgctggtgtcgctggccctgctgggctcggagcagcgcgag
gcggcgggcgtcttgtaccgcacgctcacgcacaccgactccatcatccacaactacggg
ctgcagctcaacgagggtcgcacgggcgatgagttcctcctgctcttcaccatggcctct
aaccacccggccttcagcttccaccagaagcaggtgctgcgccaggagctcacacagatc
cagagcagcctgaacagcggcggtggcggcggcggcggcggtggtggcggtggcaagagc
gcgcccgggcccagcggcgcgctgcccacctgctcggcttgccacaagatggctcccaga
actgagacccctgtcagcagcatcagcaacagcctggagaatgcattgcatacgtcagca
cattccacggaggagtccctgcccaagaggcctttgggaaaacatggcaaagtgagtgtt
gaaaagatagacctgaaggggttgtcacacacgaaaaatgacagaagtgttgagtgttcc
tttgaggtcttatggtctgattcttcaataacatcagtaacaaagtcttcctcagaagtg
actgaatttatttcaaagctatcccagctctgccctgaagagaacttggacaaactcatt
ccttgcttggctggcccagattccttctatgtggaacgtaaccatgttgatttggaagca
ggcctaaggttcttggcttcagccccttctcacacgctgaagcacgaccacgttaggaag
ttcttcagttcttcatctccctcccaacagctccaaagtccaagtcctggcaacccctcc
cttcctaaagtgggtgccgtgatgggtgtgtctggaaggcctgtgtgtggcgtggctggc
atcccatcctcacagagcagcgcccagcaccatctgcagcactcggctagcacatctgcc
tccctgccccactgctcccacacagggggcacaggctcagcgctggcataccggacccaa
gtggacaactcgcctaccatccttatgccctccagtctgcagacccctcagccccaggag
cagaatgggattttagactggcttaggaagctgcgcttgcacaagtattaccctgtcttt
aaacagctcaccatggagaagttcctgagcctcacggaagaagacctgaataaatttgag
tccctcaccatgggagcaaagaagaaactcaagactcagctggagctcgagaaggagaag
tcagagagacggtgcctcaactcctcggccccatccttggtcaccagcagcggagtggct
cgagtcacccccaccagccacgtggggcctgtgcagcctgggcgtagtagcagccacgct
tcagagctgcgggtggaggtggagccgccggctcaccagctgccccgagagggcagctcc
tccgagtactccagctcctcctccagccccatgggtgtgcaggttcgcgaggagagctca
gacagcgccgaggagagcgacagacgtgtggacatccatgtcgaggggactgagaaggag
aagcccgtgatgctgctggctcactttccgtccagctctgcgagacccacggcccaggtt
ctgcctgtgcagaacgagaccggctccagccctgccgctcaccaccctctgcccccgcag
ctcatgcctgcagcctcccacctggcgcctgtccgcatgctgaactccgtgcacaagtca
gacaggggcggagcggacgtgaagctcctctcgtcgtctgtccactcccttctgtctctg
gaggaaaggaacaagggccctggtcctagaagtggcacgaaggtggacaagagctttggt
ggtgctgtgctggacccactgccctcggcagcaccccatccaccagggcagggcctctcg
ggccttgtagagaacaacgcggtgtcacctaccgtctcctttggtccccgggccaaagtt
gtgcatgcagccacactggacagggtgctgaagacagcacagcagccagccttgactgta
gagagcagctcagctaccacagggacaccgagcaccgtcctgcatgtggcccggccaccc
atcaagctgctgctggcttcctctgtgcccgcggatgctgccatcgccgggcagacttct
tgtcccaacaacgggcagatcagcgtgccccctgcaataatgaacccccggactgctctg
tacacagccaacaccaaagttgccttctctgcggtgagcagtgtgcctgtgggcccactg
cagggcagcttctgcgccaatagcaacactgcctcccccagcagccacccctccacttct
tttgcgagcatggcctctctacccagttgcccagcccccagctccagtcccgccctctct
tctgtccccgaaagcagcttctacagtggcggtgctggcagcagctccccaggaaacatt
cctgcctcaagccagagccaccaccatcaccaccaccatcagcagccccccgcacccccc
cagcctgcaccgcccccacctggctgcattgtctgcacgtcctgtgggtgcagtggcagc
tgtggctccaacggcctgacggtcagctatgccaactacttccagcacccgttctcaggg
ccgtccgtgctcaccttccctttcttgcccttcagtcccatgtgtggcaatggctatgtc
agtacccagcagtatggtggtggctctgcctttcctgtggtacacacaccctacaatggc
agcgtgactccagaccccgtcctaggtgggcagtccacgtttgcagtgccacccatgcag
aacttcatggctgggacggcgggggtgtaccaagcccaaggcctggtgggcagcaccaat
ggctccagtcacaaaaagagtgggaatctgtcctgttacaactgtggggccactggccac
cgagcccaggactgcaagcagccgtccatggacttcaaccggcaaggaacttttaggttg
aaatacgcccctccagcagaaagtctggactccacggactga

DBGET integrated database retrieval system