KEGG   Mus musculus (mouse): 14272
Entry
14272             CDS       T01002                                 

Gene name
Fnta, FTA
Definition
(RefSeq) farnesyltransferase, CAAX box, alpha
  KO
K05955  protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha [EC:2.5.1.58 2.5.1.59]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    14272 (Fnta)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:mmu01006]
    14272 (Fnta)
Enzymes [BR:mmu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.58  protein farnesyltransferase
     14272 (Fnta)
    2.5.1.59  protein geranylgeranyltransferase type I
     14272 (Fnta)
Prenyltransferases [BR:mmu01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   14272 (Fnta)
SSDB
Motif
Pfam: PPTA PRIMA1
Other DBs
NCBI-GeneID: 14272
NCBI-ProteinID: NP_032059
MGI: 104683
Ensembl: ENSMUSG00000015994
Vega: OTTMUSG00000060878
UniProt: Q61239 Q541Z2
Position
8 A2; 8 14.27 cM
AA seq 377 aa
MAATEGVGESAAGGEPGQPEQPPPPPPPPPAQQPQEEEMAAEAGEAAASPMDDGFLSLDS
PTYVLYRDRAEWADIDPVPQNDGPNPVVQIIYSEKFRDVYDYFRAVLQRDERSERAFKLT
RDAIELNAANYTVWHFRRVLLRSLQKDLQEEMNYITAIIEEQPKNYQVWHHRRVLVEWLK
DPSQELEFIADILSQDAKNYHAWQHRQWVIQEFRLWDNELQYVDQLLKEDVRNNSVWNQR
HFVISNTTGYSDRAVLEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSRYPNLLNQLL
DLQPSHSSPYLIAFLVDVYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIG
RSLQSKHCRESDIPASV
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcggccaccgagggggtcggggaatctgcggcaggcggcgagccgggacagccggag
cagccgccgcccccgcctccgccgccgccagcacagcagccgcaggaagaagagatggcg
gctgaggccggggaagcggcggcgtcccctatggacgacgggtttctgagcctggactcg
cccacctatgtcttgtacagggacagagcagaatgggctgatatagacccagtgccccag
aatgacggccctaacccagtggtccagatcatctacagtgaaaagtttagagatgtttat
gattacttccgagctgttctgcagcgcgatgagaggagcgaacgagcctttaagctcacc
cgagacgctattgagttaaatgcagccaactacacagtgtggcattttcggagagttctc
ttaaggtcgcttcaaaaggatctacaagaggaaatgaactacatcactgcgataattgag
gagcagcccaaaaactatcaagtttggcaccacaggcgagtattagtggaatggctgaaa
gatccttctcaagagcttgaattcattgccgacattcttagtcaggatgccaagaattac
catgcctggcagcatcgacagtgggtcattcaggaattccgactttgggataatgagctg
cagtatgtagaccagcttctcaaagaggatgtgaggaataactctgtgtggaaccaaaga
cacttcgtcatttctaacaccactggctacagtgaccgcgcggtgttagagcgagaagtc
cagtatactctggaaatgatcaagttagtgccgcataatgagagcgcatggaactacctg
aaagggattctgcaggaccgtggtctttctagataccctaatctattaaatcagttgctt
gatttacaaccaagccacagttctccgtacctgattgcctttcttgtggatgtctatgaa
gacatgctagaaaaccagtgtgacaacaaggaggacattcttaataaagcactagagtta
tgtgagatcctagctaaagaaaaggacactataagaaaggaatattggaggtatattgga
cggtcccttcagagtaaacactgcagagaaagtgacataccggcgagtgtatag

DBGET integrated database retrieval system