KEGG   Mus musculus (mouse): 14276
Entry
14276             CDS       T01002                                 

Symbol
Folr2, FBP2, FR-P3, FR-beta, Folbp-2, Folbp2
Name
(RefSeq) folate receptor 2 (fetal)
  KO
K13649  folate receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01523  Antifolate resistance
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    14276 (Folr2)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    14276 (Folr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14276 (Folr2)
   04147 Exosome [BR:mmu04147]
    14276 (Folr2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
    14276 (Folr2)
Transporters [BR:mmu02000]
 Other transporters
  Others
   14276 (Folr2)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   14276 (Folr2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Receptors
  14276 (Folr2)
SSDB
Motif
Pfam: Folate_rec
Other DBs
NCBI-GeneID: 14276
NCBI-ProteinID: NP_001290160
MGI: 95569
Ensembl: ENSMUSG00000032725
Vega: OTTMUSG00000060437
UniProt: Q05685
Position
7:complement(101489195..101506397)
AA seq 251 aa
MAWKQTPLLLLVYMVTTGSGRDRTDLLNVCMDAKHHKTKPGPEDKLHDQCSPWKKNACCS
VNTSQELHKADSRLYFNWDHCGKMEPACKSHFIQDSCLYECSPNLGPWIQQVDQSWRKER
FLDVPLCKEDCHQWWEACRTSFTCKRDWHKGWDWSSGINKCPNTAPCHTFEYYFPTPASL
CEGLWSHSYKVSNYSRGSGRCIQMWFDSTQGNPNEDVVKFYASFMTSGTVPHAAVLLVPS
LAPVLSLWLPG
NT seq 756 nt   +upstreamnt  +downstreamnt
atggcctggaaacagacaccactcttgcttttggtctacatggtcacaacaggcagtggc
cgggacagaacagacctactcaacgtttgcatggatgccaaacaccataagacaaagccg
ggccccgaggacaagctgcatgaccagtgtagtccatggaagaaaaatgcctgttgctca
gtcaacaccagccaggagctacacaaggctgactcccgtctgtacttcaactgggatcac
tgtggcaagatggagcctgcctgtaagagtcacttcatccaagactcctgcctgtatgag
tgctcccccaaccttgggccttggatccagcaagtggaccagagttggcgtaaagagcgt
ttcctggatgtgcccttatgcaaagaggactgtcaccagtggtgggaagcctgtcgtacc
tcctttacctgcaagagagactggcataaaggctgggactggtcctcaggcattaacaag
tgcccaaacacagcaccctgtcacacgtttgagtactacttcccgacaccagccagcctt
tgcgagggtctctggagtcactcctacaaggtcagcaactacagcagagggagtggccgc
tgcatccagatgtggtttgactcaacccagggcaatccgaatgaggacgtggtgaagttt
tatgcttcctttatgacatctgggactgtgccccatgcagcagtacttcttgtgcccagc
ctggccccagtgctgtcattatggctccctggctga

DBGET integrated database retrieval system