KEGG   Mus musculus (mouse): 14281
Entry
14281             CDS       T01002                                 

Gene name
Fos, D12Rfj, D12Rfj1, c-f, c-fos, cF, cFos
Definition
(RefSeq) FBJ osteosarcoma oncogene
  KO
K04379  proto-oncogene protein c-fos
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04024  cAMP signaling pathway
mmu04210  Apoptosis
mmu04380  Osteoclast differentiation
mmu04620  Toll-like receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04713  Circadian entrainment
mmu04725  Cholinergic synapse
mmu04728  Dopaminergic synapse
mmu04915  Estrogen signaling pathway
mmu04917  Prolactin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu04932  Non-alcoholic fatty liver disease
mmu04935  Growth hormone synthesis, secretion and action
mmu05031  Amphetamine addiction
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05224  Breast cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    14281 (Fos)
   04668 TNF signaling pathway
    14281 (Fos)
   04024 cAMP signaling pathway
    14281 (Fos)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    14281 (Fos)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    14281 (Fos)
   04660 T cell receptor signaling pathway
    14281 (Fos)
   04658 Th1 and Th2 cell differentiation
    14281 (Fos)
   04659 Th17 cell differentiation
    14281 (Fos)
   04657 IL-17 signaling pathway
    14281 (Fos)
   04662 B cell receptor signaling pathway
    14281 (Fos)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    14281 (Fos)
   04917 Prolactin signaling pathway
    14281 (Fos)
   04921 Oxytocin signaling pathway
    14281 (Fos)
   04926 Relaxin signaling pathway
    14281 (Fos)
   04935 Growth hormone synthesis, secretion and action
    14281 (Fos)
   04928 Parathyroid hormone synthesis, secretion and action
    14281 (Fos)
  09156 Nervous system
   04725 Cholinergic synapse
    14281 (Fos)
   04728 Dopaminergic synapse
    14281 (Fos)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14281 (Fos)
  09159 Environmental adaptation
   04713 Circadian entrainment
    14281 (Fos)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14281 (Fos)
   05231 Choline metabolism in cancer
    14281 (Fos)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    14281 (Fos)
  09162 Cancer: specific types
   05210 Colorectal cancer
    14281 (Fos)
   05224 Breast cancer
    14281 (Fos)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14281 (Fos)
   05170 Human immunodeficiency virus 1 infection
    14281 (Fos)
   05161 Hepatitis B
    14281 (Fos)
   05171 Coronavirus disease - COVID-19
    14281 (Fos)
   05162 Measles
    14281 (Fos)
   05167 Kaposi sarcoma-associated herpesvirus infection
    14281 (Fos)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    14281 (Fos)
   05135 Yersinia infection
    14281 (Fos)
   05133 Pertussis
    14281 (Fos)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    14281 (Fos)
   05142 Chagas disease
    14281 (Fos)
  09163 Immune disease
   05323 Rheumatoid arthritis
    14281 (Fos)
  09165 Substance dependence
   05031 Amphetamine addiction
    14281 (Fos)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    14281 (Fos)
   05418 Fluid shear stress and atherosclerosis
    14281 (Fos)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    14281 (Fos)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    14281 (Fos)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14281 (Fos)
   04131 Membrane trafficking [BR:mmu04131]
    14281 (Fos)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    14281 (Fos)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    14281 (Fos)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Macoilin DUF3450 HALZ
Other DBs
NCBI-GeneID: 14281
NCBI-ProteinID: NP_034364
MGI: 95574
Ensembl: ENSMUSG00000021250
Vega: OTTMUSG00000019764
UniProt: P01101
Structure
PDB: 
2WT7

Position
12 D2; 12 39.7 cM
AA seq 380 aa
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNTQDFCADLSVSSANF
IPTVTAISTSPDLQWLVQPTLVSSVAPSQTRAPHPYGLPTQSAGAYARAGMVKTVSGGRA
QSIGRRGKVEQLSPEEEEKRRIRRERNKMAAAKCRNRRRELTDTLQAETDQLEDEKSALQ
TEIANLLKEKEKLEFILAAHRPACKIPDDLGFPEEMSVASLDLTGGLPEASTPESEEAFT
LPLLNDPEPKPSLEPVKSISNVELKAEPFDDFLFPASSRPSGSETSRSVPDVDLSGSFYA
ADWEPLHSNSLGMGPMVTELEPLCTPVVTCTPGCTTYTSSFVFTYPEADSFPSCAAAHRK
GSSSNEPSSDSLSSPTLLAL
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgatgttctcgggtttcaacgccgactacgaggcgtcatcctcccgctgcagtagcgcc
tccccggccggggacagcctttcctactaccattccccagccgactccttctccagcatg
ggctctcctgtcaacacacaggacttttgcgcagatctgtccgtctctagtgccaacttt
atccccacggtgacagccatctccaccagcccagacctgcagtggctggtgcagcccact
ctggtctcctccgtggccccatcgcagaccagagcgccccatccttacggactccccacc
cagtctgctggggcttacgccagagcgggaatggtgaagaccgtgtcaggaggcagagcg
cagagcatcggcagaaggggcaaagtagagcagctatctcctgaagaggaagagaaacgg
agaatccgaagggaacggaataagatggctgcagccaagtgccggaatcggaggagggag
ctgacagatacactccaagcggagacagatcaacttgaagatgagaagtctgcgttgcag
actgagattgccaatctgctgaaagagaaggaaaaactggagtttattttggcagcccac
cgacctgcctgcaagatccccgatgaccttggcttcccagaggagatgtctgtggcctcc
ctggatttgactggaggtctgcctgaggcttccaccccagagtctgaggaggccttcacc
ctgccccttctcaacgaccctgagcccaagccatccttggagccagtcaagagcatcagc
aacgtggagctgaaggcagaaccctttgatgacttcttgtttccggcatcatctaggccc
agtggctcagagacctcccgctctgtgccagatgtggacctgtccggttccttctatgca
gcagactgggagcctctgcacagcaattccttggggatggggcccatggtcacagagctg
gagcccctgtgtactcccgtggtcacctgtactccgggctgcactacttacacgtcttcc
tttgtcttcacctaccctgaagctgactccttcccaagctgtgccgctgcccaccgaaag
ggcagcagcagcaacgagccctcctccgactccctgagctcacccacgctgctggccctg
tga

KEGG   Mus musculus (mouse): 14282
Entry
14282             CDS       T01002                                 

Gene name
Fosb
Definition
(RefSeq) FBJ osteosarcoma oncogene B
  KO
K09029  protein FosB
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04657  IL-17 signaling pathway
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    14282 (Fosb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14282 (Fosb)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    14282 (Fosb)
   05031 Amphetamine addiction
    14282 (Fosb)
   05034 Alcoholism
    14282 (Fosb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14282 (Fosb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    14282 (Fosb)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2 DUF4407 DivIC DUF3450 FapA Spc24
Other DBs
NCBI-GeneID: 14282
NCBI-ProteinID: NP_032062
MGI: 95575
Ensembl: ENSMUSG00000003545
Vega: OTTMUSG00000059145
UniProt: P13346 A2RSD4
Position
7 A3; 7 9.56 cM
AA seq 338 aa
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPAVDPYDMPGTSYSTPGLSAYSTGGASGS
GGPSTSTTTSGPVSARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSTSAKEDGFGWLLPPPPPPPLPFQSSRDAPPNLTASLFTHSEVQVLGDPFPVVSPSY
TSSFVLTCPEVSAFAGAQRTSGSEQPSDPLNSPSLLAL
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgtttcaagcttttcccggagactacgactccggctcccggtgtagctcatcaccctcc
gccgagtctcagtacctgtcttcggtggactccttcggcagtccacccaccgccgccgcc
tcccaggagtgcgccggtctcggggaaatgcccggctccttcgtgccaacggtcaccgca
atcacaaccagccaggatcttcagtggctcgtgcaacccaccctcatctcttccatggcc
cagtcccaggggcagccactggcctcccagcctccagctgttgacccttatgacatgcca
ggaaccagctactcaaccccaggcctgagtgcctacagcactggcggggcaagcggaagt
ggtgggccttcaaccagcacaaccaccagtggacctgtgtctgcccgtccagccagagcc
aggcctagaagaccccgagaagagacacttaccccagaagaagaagaaaagcgaagggtt
cgcagagagcggaacaagctggctgcagctaagtgcaggaaccgtcggagggagctgaca
gatcgacttcaggcggaaactgatcagcttgaagaggaaaaggcagagctggagtcggag
atcgccgagctgcaaaaagagaaggaacgcctggagtttgtcctggtggcccacaaaccg
ggctgcaagatcccctacgaagaggggccggggccaggcccgctggccgaggtgagagat
ttgccagggtcaacatccgctaaggaagacggcttcggctggctgctgccgccccctcca
ccaccgcccctgcccttccagagcagccgagacgcaccccccaacctgacggcttctctc
tttacacacagtgaagttcaagtcctcggcgaccccttccccgttgttagcccttcgtac
acttcctcgtttgtcctcacctgcccggaggtctccgcgttcgccggcgcccaacgcacc
agcggcagcgagcagccgtccgacccgctgaactcgccctcccttcttgctctgtaa

KEGG   Mus musculus (mouse): 14283
Entry
14283             CDS       T01002                                 

Gene name
Fosl1, AW538199, Fr, Fra1, fra, fra-1
Definition
(RefSeq) fos-like antigen 1
  KO
K04502  fos-like antigen 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04380  Osteoclast differentiation
mmu04657  IL-17 signaling pathway
mmu05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14283 (Fosl1)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    14283 (Fosl1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14283 (Fosl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    14283 (Fosl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14283 (Fosl1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    14283 (Fosl1)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF3450 DUF4527 Macoilin TMCO5 DUF4407
Other DBs
NCBI-GeneID: 14283
NCBI-ProteinID: NP_034365
MGI: 107179
Ensembl: ENSMUSG00000024912
UniProt: P48755 Q3UMK5
Position
19 A; 19 4.33 cM
AA seq 273 aa
MYRDYGEPGPSSGAGSPYGRPAQPPQAQAQTAQQQKFHLVPSIDSSSQELHWMVQPHFLG
PTGYPRPLAYPQYSPPQPRPGVIRALGPPPGVRRRPCEQISPEEEERRRVRRERNKLAAA
KCRNRRKELTDFLQAETDKLEDEKSGLQREIEELQKQKERLELVLEAHRPICKIPEGDKK
DPGGSGSTSGASSPPAPGRPVPCISLSPGPVLEPEALHTPTLMTTPSLTPFTPSLVFTYP
STPEPCSSAHRKSSSSSGDPSSDPLGSPTLLAL
NT seq 822 nt   +upstreamnt  +downstreamnt
atgtaccgagactacggggaaccgggaccgagctccggggctggcagcccgtacggtcgc
cccgcgcagcccccgcaagctcaggcacagaccgcccagcagcagaagttccaccttgtg
ccaagcatcgacagcagcagccaggaactgcactggatggtgcagcctcatttcctggga
cccactggctatccccgacctctggcctatccccagtacagtccccctcagccccggcca
ggagtcatacgagccctagggccacctccgggggtgcgtcgcaggccctgcgagcagatc
agcccagaggaggaagagcgccgcagggtgagacgcgagcggaacaagctagcagctgct
aagtgcagaaaccgaagaaaggagctgacagacttcctgcaggcggagaccgacaaattg
gaggatgagaaatcggggctgcagcgagagattgaagagctgcagaagcagaaggaacgc
cttgagctggtgctggaagcccatcgccccatctgcaaaatcccagaaggagacaagaag
gacccaggtggttctggcagcaccagcggtgctagcagcccaccagcccccggccgccca
gtgccttgcatctccctttctccaggacccgtacttgaaccggaagcactgcataccccc
acgctcatgaccacaccctctctgactccttttactccgagtctggttttcacctatcct
agcacaccagaaccttgctcctccgctcaccgaaagagtagcagcagcagtggcgacccc
tcctccgaccccctgggctctcctacactcctggctttgtga

KEGG   Mus musculus (mouse): 14284
Entry
14284             CDS       T01002                                 

Gene name
Fosl2, Fra, Fra-2
Definition
(RefSeq) fos-like antigen 2
  KO
K09030  fos-like antigen 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14284 (Fosl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14284 (Fosl2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    14284 (Fosl2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ZapB DUF4527 DUF4407 UPF0242
Other DBs
NCBI-GeneID: 14284
NCBI-ProteinID: NP_032063
MGI: 102858
Ensembl: ENSMUSG00000029135
Vega: OTTMUSG00000055218
UniProt: P47930
Position
5 B1; 5 17.33 cM
AA seq 326 aa
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDL
QWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKL
EFMLVAHGPVCKISPEERRSPPTSGLQSLRGTGSAVGPVVVKQEPPEEDSPSSSAGMDKT
QRSVIKPISIAGGGFYGEEPLHTPIVVTSTPAITPGTSNLVFTYPNVLEQESPSSPSESC
SKAHRRSSSSGDQSSDSLNSPTLLAL
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtaccaggattatcccgggaactttgacacctcgtcccggggcagcagcggctctcct
gcgcacgccgagtcctactccagcggtggcggcggccagcagaagttccgggtagatatg
cctggctcgggcagtgccttcatccccacaatcaacgccatcaccaccagccaggacctg
cagtggatggtacagcccacagtgatcacctccatgtccaatccctatccacgctcacat
ccctacagtcccctgccaggcctggcttcagtccctgggcacatggctctccccagacct
ggagtgatcaagaccatcggtaccaccgtgggccgcagaaggagagatgagcagctgtct
cctgaggaggaggagaagcgtcgaatccggagggagagaaacaagctagctgcagccaag
tgtcggaaccgtcgccgggagctgacagagaagctgcaggcggagaccgaggagctggaa
gaggagaagtctgggctgcagaaagagattgctgagctgcagaaggagaaggagaagcta
gagttcatgttggtggctcacggccccgtgtgcaaaatcagccccgaggaacgccgatcg
ccccccacctccgggctgcagtccttgcgcggtacgggcagtgccgttggccccgtggtg
gtgaagcaggagcctcccgaagaggacagcccctcttcctcagcagggatggacaagacc
cagcgctctgtcatcaagcccatcagcatcgccgggggtggtttctacggggaagagcct
ctgcacacccccatcgtggtgacctccacgcctgccatcactcccggcacttcaaacctt
gtcttcacctaccccaatgtcctggagcaggagtcgccttcgtcgccctcagagtcctgc
tccaaggctcaccgcagaagcagtagcagtggggaccagtcatcagactccttgaactcc
cccacacttctagccctgtaa

KEGG   Mus musculus (mouse): 16476
Entry
16476             CDS       T01002                                 

Gene name
Jun, AP-1, Junc, c-ju, c-jun
Definition
(RefSeq) jun proto-oncogene
  KO
K04448  transcription factor AP-1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04024  cAMP signaling pathway
mmu04137  Mitophagy - animal
mmu04210  Apoptosis
mmu04310  Wnt signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04912  GnRH signaling pathway
mmu04915  Estrogen signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05030  Cocaine addiction
mmu05031  Amphetamine addiction
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05203  Viral carcinogenesis
mmu05210  Colorectal cancer
mmu05211  Renal cell carcinoma
mmu05224  Breast cancer
mmu05231  Choline metabolism in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05321  Inflammatory bowel disease
mmu05323  Rheumatoid arthritis
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16476 (Jun)
   04012 ErbB signaling pathway
    16476 (Jun)
   04310 Wnt signaling pathway
    16476 (Jun)
   04668 TNF signaling pathway
    16476 (Jun)
   04024 cAMP signaling pathway
    16476 (Jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    16476 (Jun)
  09143 Cell growth and death
   04210 Apoptosis
    16476 (Jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    16476 (Jun)
   04530 Tight junction
    16476 (Jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    16476 (Jun)
   04621 NOD-like receptor signaling pathway
    16476 (Jun)
   04625 C-type lectin receptor signaling pathway
    16476 (Jun)
   04660 T cell receptor signaling pathway
    16476 (Jun)
   04658 Th1 and Th2 cell differentiation
    16476 (Jun)
   04659 Th17 cell differentiation
    16476 (Jun)
   04657 IL-17 signaling pathway
    16476 (Jun)
   04662 B cell receptor signaling pathway
    16476 (Jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    16476 (Jun)
   04915 Estrogen signaling pathway
    16476 (Jun)
   04921 Oxytocin signaling pathway
    16476 (Jun)
   04926 Relaxin signaling pathway
    16476 (Jun)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    16476 (Jun)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16476 (Jun)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    16476 (Jun)
   05203 Viral carcinogenesis
    16476 (Jun)
   05231 Choline metabolism in cancer
    16476 (Jun)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    16476 (Jun)
  09162 Cancer: specific types
   05210 Colorectal cancer
    16476 (Jun)
   05211 Renal cell carcinoma
    16476 (Jun)
   05224 Breast cancer
    16476 (Jun)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16476 (Jun)
   05170 Human immunodeficiency virus 1 infection
    16476 (Jun)
   05161 Hepatitis B
    16476 (Jun)
   05171 Coronavirus disease - COVID-19
    16476 (Jun)
   05162 Measles
    16476 (Jun)
   05167 Kaposi sarcoma-associated herpesvirus infection
    16476 (Jun)
   05169 Epstein-Barr virus infection
    16476 (Jun)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    16476 (Jun)
   05135 Yersinia infection
    16476 (Jun)
   05133 Pertussis
    16476 (Jun)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    16476 (Jun)
   05142 Chagas disease
    16476 (Jun)
  09163 Immune disease
   05323 Rheumatoid arthritis
    16476 (Jun)
   05321 Inflammatory bowel disease
    16476 (Jun)
  09165 Substance dependence
   05030 Cocaine addiction
    16476 (Jun)
   05031 Amphetamine addiction
    16476 (Jun)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    16476 (Jun)
   05418 Fluid shear stress and atherosclerosis
    16476 (Jun)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    16476 (Jun)
   04933 AGE-RAGE signaling pathway in diabetic complications
    16476 (Jun)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    16476 (Jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16476 (Jun)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    16476 (Jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB PspA_IM30 FlaC_arch TFIIA NBP1 Fib_alpha DUF3450
Other DBs
NCBI-GeneID: 16476
NCBI-ProteinID: NP_034721
MGI: 96646
Ensembl: ENSMUSG00000052684
Vega: OTTMUSG00000008035
UniProt: P05627 Q52L79
Position
4 C5; 4 43.34 cM
AA seq 334 aa
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDL
LTSPDVGLLKLASPELERLIIQSSNGHITTTPTPTQFLCPKNVTDEQEGFAEGFVRALAE
LHSQNTLPSVTSAAQPVSGAGMVAPAVASVAGAGGGGGYSASLHSEPPVYANLSNFNPGA
LSSGGGAPSYGAAGLAFPSQPQQQQQPPQPPHHLPQQIPVQHPRLQALKEEPQTVPEMPG
ETPPLSPIDMESQERIKAERKRMRNRIAASKCRKRKLERIARLEEKVKTLKAQNSELAST
ANMLREQVAQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgactgcaaagatggaaacgaccttctacgacgatgccctcaacgcctcgttcctccag
tccgagagcggtgcctacggctacagtaaccctaagatcctaaaacagagcatgaccttg
aacctggccgacccggtgggcagtctgaagccgcacctccgcgccaagaactcggacctt
ctcacgtcgcccgacgtcgggctgctcaagctggcgtcgccggagctggagcgcctgatc
atccagtccagcaatgggcacatcaccactacaccgacccccacccagttcttgtgcccc
aagaacgtgaccgacgagcaggagggcttcgccgagggcttcgtgcgcgccctggctgaa
ctgcatagccagaacacgcttcccagtgtcacctccgcggcacagccggtcagcggggcg
ggcatggtggctcccgcggtggcctcagtagcaggcgctggcggcggtggtggctacagc
gccagcctgcacagtgagcctccggtctacgccaacctcagcaacttcaacccgggtgcg
ctgagcagcggcggtggggcgccctcctatggcgcggccgggctggcctttccctcgcag
ccgcagcagcagcagcagccgcctcagccgccgcaccacttgccccaacagatcccggtg
cagcacccgcggctgcaagccctgaaggaagagccgcagaccgtgccggagatgccggga
gagacgccgcccctgtcccctatcgacatggagtctcaggagcggatcaaggcagagagg
aagcgcatgaggaaccgcattgccgcctccaagtgccggaaaaggaagctggagcggatc
gctcggctagaggaaaaagtgaaaaccttgaaagcgcaaaactccgagctggcatccacg
gccaacatgctcagggaacaggtggcacagcttaagcagaaagtcatgaaccacgttaac
agtgggtgccaactcatgctaacgcagcagttgcaaacgttttga

KEGG   Mus musculus (mouse): 16477
Entry
16477             CDS       T01002                                 

Gene name
Junb
Definition
(RefSeq) jun B proto-oncogene
  KO
K09028  transcription factor jun-B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
mmu04668  TNF signaling pathway
mmu04935  Growth hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    16477 (Junb)
 09150 Organismal Systems
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    16477 (Junb)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16477 (Junb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16477 (Junb)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    16477 (Junb)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_2 bZIP_Maf ZapB MAD
Other DBs
NCBI-GeneID: 16477
NCBI-ProteinID: NP_032442
MGI: 96647
Ensembl: ENSMUSG00000052837
Vega: OTTMUSG00000061397
UniProt: P09450 Q569U6
Position
8 C3; 8 41.41 cM
AA seq 344 aa
MCTKMEQPFYHDDSYAAAGYGRSPGSLSLHDYKLLKPTLALNLADPYRGLKGPGARGPGP
EGSGAGSYFSGQGSDTGASLKLASTELERLIVPNSNGVITTTPTPPGQYFYPRGGGSGGG
TGGGVTEEQEGFADGFVKALDDLHKMNHVTPPNVSLGASGGPQAGPGGVYAGPEPPPVYT
NLSSYSPASAPSGGSGTAVGTGSSYPTATISYLPHAPPFAGGHPAQLGLSRGASAFKEEP
QTVPEARSRDATPPVSPINMEDQERIKVERKRLRNRLAATKCRKRKLERIARLEDKVKTL
KAENAGLSSAAGLLREQVAQLKQKVMTHVSNGCQLLLGVKGHAF
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgtgcacgaaaatggaacagcctttctatcacgacgactcttacgcagcggcgggatac
ggtcggagccctggcagcctgtctctacacgactacaaactcctgaaacccaccttggcg
ctcaacctggcggatccctatcggggtctcaagggtcctggggcgcggggtccaggcccg
gagggcagtggggcaggcagctacttttcgggtcagggatcagacacaggcgcatctctg
aagctagcctccacggaactggagcgcttgatcgtccccaacagcaacggcgtgatcacg
acgacgcccacgcctccgggacagtacttttacccccgtgggggtggcagcggtggaggt
acagggggcggcgtcaccgaggagcaggagggctttgcggacggttttgtcaaagccctg
gacgacctgcacaagatgaaccacgtgacgccccccaacgtgtccctgggcgccagcggg
ggtccccaggccggcccagggggcgtctatgctggtccggagccgcctcccgtctacacc
aacctcagcagttactccccagcctctgcaccctctggaggctccgggaccgccgtcggg
actgggagctcatacccgacggccaccatcagctacctcccacatgcaccaccctttgcg
ggcggccacccggcacagctgggcttgagtcgcggcgcttccgcctttaaagaggaaccg
cagaccgtaccggaggcacgcagccgcgacgccacgccgcctgtgtcccccatcaacatg
gaagaccaggagcgcatcaaagtggagcgaaagcggctgcggaacaggctggcggccacc
aagtgccggaagcggaagctggagcgcatcgcgcgcctggaggacaaggtgaagacactc
aaggctgagaacgcggggctgtcgagtgctgccggtctcctacgggagcaagtggcgcag
ctcaagcagaaggtcatgacccatgtcagcaacggctgccagttgctgctaggggtcaag
ggacacgccttctga

KEGG   Mus musculus (mouse): 16478
Entry
16478             CDS       T01002                                 

Gene name
Jund, Jund1
Definition
(RefSeq) jun D proto-oncogene
  KO
K04449  transcription factor jun-D
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04380  Osteoclast differentiation
mmu04657  IL-17 signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    16478 (Jund)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    16478 (Jund)
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    16478 (Jund)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16478 (Jund)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    16478 (Jund)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    16478 (Jund)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB TSC22 DUF3450 Fib_alpha FlaC_arch TEX13 DUF724 PspA_IM30
Other DBs
NCBI-GeneID: 16478
NCBI-ProteinID: NP_034722
MGI: 96648
Ensembl: ENSMUSG00000071076
Vega: OTTMUSG00000061455
UniProt: P15066
Position
8 B3.3; 8 34.15 cM
AA seq 341 aa
METPFYGEEALSGLAAGASSVAGATGAPGGGGFAPPGRAFPGAPPTSSMLKKDALTLSLA
EQGAAGLKPGSATAPSALRPDGAPDGLLASPDLGLLKLASPELERLIIQSNGLVTTTPTS
TQFLYPKVAASEEQEFAEGFVKALEDLHKQSQLGAATAATSGAPAPPAPADLAATPGATE
TPVYANLSSFAGGAGPPGGAATVAFAAEPVPFPPPPGALGPPPPPHPPRLAALKDEPQTV
PDVPSFGDSPPLSPIDMDTQERIKAERKRLRNRIAASKCRKRKLERISRLEEKVKTLKSQ
NTELASTASLLREQVAQLKQKVLSHVNSGCQLLPQHQVPAY
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggaaacgcccttctatggcgaggaggcgctgagcggcctggctgcgggtgcgtcgagc
gtcgctggtgctactggggcccccggcggtggtggcttcgcgcccccgggccgcgctttc
cccggggcgcccccgacgagcagcatgctgaagaaagacgcgctgacgctcagcctggcg
gagcagggagcggcgggattgaaaccagggtcggccactgcaccttctgcgctgcgcccc
gacggcgcccccgacgggctgctggcttcgccggatcttgggctgctcaaactcgcgtcg
ccggagctggagaggctgatcatccagtccaacgggctggtgaccactaccccgaccagt
acgcagttcctctacccgaaggtggcagctagcgaggagcaggagttcgccgaaggcttc
gtcaaggcgctggaggacctgcacaagcaaagccagctgggtgcggccaccgcggccacc
tcaggggctcccgcgcctcccgcgcccgccgacctggccgccacccccggggccacggag
accccggtctacgccaacctgagcagtttcgcgggtggcgccgggccccctgggggcgcg
gccaccgtggctttcgccgcggagccagtgcccttcccgccgcccccgggcgcgctgggg
ccgccgccacctccgcatccaccgcgcctggccgcgctcaaggacgagccgcagaccgtg
ccggacgtgccgagcttcggcgacagccctccgctgtcgcccatcgacatggacacgcaa
gaacgcatcaaggcggagcgcaagaggctgcgcaaccgcatcgccgcctccaaatgccgc
aagcgcaagctggagcgtatctcgcgcctggaggagaaagtcaagaccctcaaaagccag
aacaccgagctggcgtccaccgccagcctgctgcgcgagcaggtggcgcagctcaaacag
aaagtcctcagccacgtcaacagcggctgccagctgctgccccagcaccaggtcccggcg
tactga

DBGET integrated database retrieval system