KEGG   Mus musculus (mouse): 14284
Entry
14284             CDS       T01002                                 

Gene name
Fosl2, Fra-2
Definition
(RefSeq) fos-like antigen 2
  KO
K09030  fos-like antigen 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14284 (Fosl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14284 (Fosl2)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    14284 (Fosl2)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf ASD2 UPF0242 DUF4407
Other DBs
NCBI-GeneID: 14284
NCBI-ProteinID: NP_032063
MGI: 102858
Ensembl: ENSMUSG00000029135
Vega: OTTMUSG00000055218
UniProt: P47930
Position
5 B1; 5 17.33 cM
AA seq 326 aa
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDL
QWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLS
PEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKL
EFMLVAHGPVCKISPEERRSPPTSGLQSLRGTGSAVGPVVVKQEPPEEDSPSSSAGMDKT
QRSVIKPISIAGGGFYGEEPLHTPIVVTSTPAITPGTSNLVFTYPNVLEQESPSSPSESC
SKAHRRSSSSGDQSSDSLNSPTLLAL
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtaccaggattatcccgggaactttgacacctcgtcccggggcagcagcggctctcct
gcgcacgccgagtcctactccagcggtggcggcggccagcagaagttccgggtagatatg
cctggctcgggcagtgccttcatccccacaatcaacgccatcaccaccagccaggacctg
cagtggatggtacagcccacagtgatcacctccatgtccaatccctatccacgctcacat
ccctacagtcccctgccaggcctggcttcagtccctgggcacatggctctccccagacct
ggagtgatcaagaccatcggtaccaccgtgggccgcagaaggagagatgagcagctgtct
cctgaggaggaggagaagcgtcgaatccggagggagagaaacaagctagctgcagccaag
tgtcggaaccgtcgccgggagctgacagagaagctgcaggcggagaccgaggagctggaa
gaggagaagtctgggctgcagaaagagattgctgagctgcagaaggagaaggagaagcta
gagttcatgttggtggctcacggccccgtgtgcaaaatcagccccgaggaacgccgatcg
ccccccacctccgggctgcagtccttgcgcggtacgggcagtgccgttggccccgtggtg
gtgaagcaggagcctcccgaagaggacagcccctcttcctcagcagggatggacaagacc
cagcgctctgtcatcaagcccatcagcatcgccgggggtggtttctacggggaagagcct
ctgcacacccccatcgtggtgacctccacgcctgccatcactcccggcacttcaaacctt
gtcttcacctaccccaatgtcctggagcaggagtcgccttcgtcgccctcagagtcctgc
tccaaggctcaccgcagaagcagtagcagtggggaccagtcatcagactccttgaactcc
cccacacttctagccctgtaa

DBGET integrated database retrieval system