KEGG   Mus musculus (mouse): 14287Help
Entry
14287             CDS       T01002                                 

Gene name
Fpgs, AA408187
Definition
(RefSeq) folylpolyglutamyl synthetase
  KO
K01930  folylpolyglutamate synthase [EC:6.3.2.17]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00790  Folate biosynthesis
mmu01100  Metabolic pathways
mmu01523  Antifolate resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    14287 (Fpgs)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    14287 (Fpgs)
Enzymes [BR:mmu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.17  tetrahydrofolate synthase
     14287 (Fpgs)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C
Motif
Other DBs
NCBI-GeneID: 14287
NCBI-ProteinID: NP_034366
MGI: 95576
Ensembl: ENSMUSG00000009566
Vega: OTTMUSG00000012531
UniProt: P48760
Position
2 B; 2 22.09 cM
AA seq 587 aa AA seqDB search
MSWARSRLCSTLSLAAVSARGATTEGAARRGMSAWPAPQEPGMEYQDAVRTLNTLQTNAS
YLEQVKRQRSDPQAQLEAMEMYLARSGLQVEDLNRLNIIHVTGTKGKGSTCAFTERILRN
YGLKTGFFSSPHMVQVRERIRINGKPISPELFTKHFWCLYNQLEEFKDDSHVSMPSYFRF
LTLMAFHVFLQEKVDLAVVEVGIGGAFDCTNIIRKPVVCGVSSLGIDHTSLLGDTVEKIA
WQKGGIFKPGVPAFTVVQPEGPLAVLRDRAQQIGCPLYLCPPLEALEEVGLPLSLGLEGA
HQRSNAALALQLAHCWLERQDHQDIQELKVSRPSIRWQLPLAPVFRPTPHMRRGLRDTVW
PGRTQILQRGPLTWYLDGAHTTSSVQACVHWYRQSLERSKRTDGGSEVHILLFNSTGDRD
SAALLKLLQPCQFDYAVFCPNVTEVSSIGNADQQNFTVTLDQVLLRCLQHQQHWNGLAEK
QASSNLWSSCGPDPAGPGSLLLAPHPPQPTRTSSLVFSCISHALLWISQGRDPIFQPQSL
PRNLLNHPTANSGASILREAAAIHVLVTGSLHLVGGVLKLLDPSMSQ
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggcgcggagccgactgtgctcgactctgtccctggcagctgtttctgcgcgt
ggtgcaacgacggagggcgcggcgcggcgggggatgagcgcgtggccagcgccacaggag
ccgggcatggagtatcaggatgctgtgcgcacgctcaacaccctgcaaaccaatgccagc
tacctggagcaggtaaagcgccaacggagtgacccccaggcgcagctggaggctatggag
atgtacctggcacggagtggactgcaggtggaggacttgaaccggctaaacattattcat
gtcactgggaccaaagggaagggctccacctgtgccttcaccgaacggatcctgcggaat
tacggcctgaagaccggcttctttagctctcctcacatggtgcaggtgcgggagcggatt
cgaatcaacgggaaaccaatcagccccgagctcttcaccaagcacttctggtgcctctat
aaccagctggaggagttcaaggacgacagccatgtctccatgccctcttacttccgcttc
ctcacactcatggccttccatgtcttcctccaagagaaggtggacctggcagtggtggag
gtgggcattggcggggcttttgactgcaccaacatcatcagaaagccagtggtgtgtgga
gtctcctctcttggcattgaccacaccagtctactaggagatacagtggagaaaatagca
tggcagaaagggggcatctttaagcctggtgtccctgccttcactgtggtgcagccagaa
ggtcccctggctgtgctgagggatcgagcccagcagattggatgcccgttgtacctgtgt
ccgccattggaagccctggaggaggttggactgccattgagcctgggtctggagggagca
caccagcggtctaatgctgccttggccttgcagctggcccactgttggctggagcggcag
gaccaccaagacatccaggagctgaaggtatccaggccaagcatacggtggcagctgccc
ctggcacctgtgttccgccctacccctcacatgaggcgtgggcttcgggacacagtgtgg
cctggccggacacagatactccagcggggaccccttacctggtacctggatggcgcccat
accaccagcagtgtgcaggcctgtgtgcactggtaccgccagtcattggagcgcagcaaa
cgcaccgatggagggtccgaagtacacatcttgctcttcaactctactggtgacagggac
tctgctgccctgctgaagctgctgcagccctgccagtttgactacgctgtcttctgcccc
aacgtgacagaggtttcatccataggaaatgcagaccagcagaacttcactgtgactctg
gaccaggtgctgctccgctgcctccaacaccagcagcattggaacggcctggctgagaaa
caggccagctccaacctctggagcagctgcggcccagaccctgctgggccaggctccctg
ctgctggccccgcacccacctcagcctactaggacgagctccctcgttttcagctgcatc
tcccacgccttgctgtggatcagccaaggccgggatcccatctttcagccccagagcctt
ccaaggaatcttctcaaccaccccacagccaacagcggggccagcattctccgtgaggct
gctgccatccatgtactggttacaggaagcctgcacctggtgggcggggttctgaaactg
ctggatccctctatgtcccagtag

DBGET integrated database retrieval system