KEGG   Mus musculus (mouse): 14289
Entry
14289             CDS       T01002                                 

Gene name
Fpr2, E330010I07Rik, Fpr, Fpr-rs2
Definition
(RefSeq) formyl peptide receptor 2
  KO
K04173  formyl peptide receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04613  Neutrophil extracellular trap formation
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14289 (Fpr2)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    14289 (Fpr2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14289 (Fpr2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14289 (Fpr2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    14289 (Fpr2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 14289
NCBI-ProteinID: NP_032065
MGI: 1278319
Ensembl: ENSMUSG00000052270
Vega: OTTMUSG00000021056
UniProt: O88536
Position
17; 17 A3.2
AA seq 351 aa
MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVT
TIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIA
LDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNF
GSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPM
LYVFMGQDFRERFIHSLPYSLERALSEDSGQTSDSSTSSTSPPADIELKAP
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggaatccaactactccatccatctgaatggatcagaagtggtggtttatgattctacc
atctccagagttctgtggatcctctcaatggtggttgtctccatcactttcttccttggt
gtgctgggcaatggactagtgatttgggtagctggattccggatgccacacactgtcacc
actatctggtatctgaatctagcattggctgacttttctttcacagcaactctaccattc
cttcttgttgaaatggctatgaaagaaaaatggccttttggctggttcctgtgtaaatta
gttcacattgtggtagatgtaaacctgtttggaagtgtcttcttgattgctctcattgcc
ttggaccgctgcatttgtgttctgcatccagtctgggctcagaaccaccgcactgtgagc
ctggctaggaaggtggttgttgggccctggatttttgctctgattctcactttgcccatt
tttattttcttgactactgttagaattcctggaggagatgtgtattgtacattcaacttt
ggatcctgggctcaaactgatgaagaaaagttgaacacagctatcacttttgtaacaact
agagggatcatcaggttccttattggtttcagcatgcccatgtcaattgttgctgtttgc
tatggactcattgctgtcaagatcaacagaagaaaccttgttaattccagccgtccttta
cgagtccttacagcagttgtggcttccttctttatctgctggtttccctttcagcttgtg
gcccttttgggcacagtctggtttaaagagacattgcttagtggtagttataaaattctt
gacatgtttgttaacccaacaagctcattggcttacttcaatagttgtctcaatccgatg
ctctatgttttcatgggccaggactttcgtgagagatttattcattccctgccttatagt
cttgagagagccctgagtgaggattctggtcaaaccagtgattcaagcaccagttctact
tcacctcctgcagacattgagttaaaggccccatga

KEGG   Mus musculus (mouse): 14290
Entry
14290             CDS       T01002                                 

Gene name
Fpr-rs3
Definition
(RefSeq) formyl peptide receptor, related sequence 3
  KO
K04173  formyl peptide receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04613  Neutrophil extracellular trap formation
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14290 (Fpr-rs3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    14290 (Fpr-rs3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14290 (Fpr-rs3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14290 (Fpr-rs3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    14290 (Fpr-rs3)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 14290
NCBI-ProteinID: NP_032066
MGI: 1278318
Ensembl: ENSMUSG00000060701
Vega: OTTMUSG00000039785
UniProt: O88537
Position
17; 17 A3.2
AA seq 343 aa
MEANSSIPLNGSEVVFYDSTTSRVLWILSVIVLSITFVLGVLGNGLVIWVAGFRMAHTVT
TICYLNLALGDFSFMVTLPLHIISMVMKGKWLFGWFLCKFVLSIVHINLFVSVFLITLIA
MDRCTCVLHPVWVQNHRTVSLARKVIVGAWILSLLLTLPHFLFLTTVRDARGEVHCTCNF
ESVVANPEEQLKVSITVSTATGIISFIIGFSLPMSFIAVCYGLMAAKICRKGFLNSSRPL
RVLTAVAISFFMCWFPFQLIILLGNIWNKETPSSIHILLNPASTLASFNSCLNPILYVFL
GQEFREKLIYSLSASLERALREDSVLSSGKSSNFSSCPADSEL
NT seq 1032 nt   +upstreamnt  +downstreamnt
atggaagccaactcctccatcccactgaatggctcagaagtggtgttttatgattctacc
acctccagagttctatggatcctctcagtgatagttctctccataacctttgtccttggt
gtgctaggtaatgggcttgtgatttgggtggctgggttccggatggcacacactgtgacc
accatctgttatctgaacctggctttgggtgacttctctttcatggttactttaccacta
cacatcatctcaatggtcatgaaaggaaaatggctttttggttggttcctttgcaaattt
gttctcagcattgtgcacataaacctttttgtaagtgttttcttaatcactctcattgcc
atggatcgttgtacttgtgtcctgcacccagtatgggttcagaatcaccgaactgtgagt
ctggccaggaaagtgattgttggagcttggattctttctctgctgcttacattgccacat
tttctcttcttgactacagtgagagatgcaagaggcgaagtgcactgtacatgtaacttt
gaatctgtggttgcaaaccctgaggagcaattaaaggtgtcaattaccgtgagcacagca
acaggaatcatcagttttattattggcttcagcctacccatgtccttcattgccgtctgc
tatggactcatggctgccaagatttgtagaaaaggctttctgaactccagccgtccttta
cgtgttctcactgctgtagcaatttccttctttatgtgttggttcccttttcaactgatt
attcttctaggtaatatctggaataaggagacaccaagcagcattcacattttgttgaac
ccagcaagcacactggcttccttcaacagctgtctcaacccaatactctatgtctttctt
ggtcaagaatttagagagaaactgatatattccctgtctgccagtctggagagggcgctg
cgagaagactcagtcctaagcagtggcaaaagcagcaacttttcttcatgtcctgccgac
tctgaactatag

KEGG   Mus musculus (mouse): 14291
Entry
14291             CDS       T01002                                 

Gene name
Fpr-rs4
Definition
(RefSeq) formyl peptide receptor, related sequence 4
  KO
K04173  formyl peptide receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04613  Neutrophil extracellular trap formation
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14291 (Fpr-rs4)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    14291 (Fpr-rs4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14291 (Fpr-rs4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14291 (Fpr-rs4)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    14291 (Fpr-rs4)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 14291
NCBI-ProteinID: NP_032067
MGI: 1278317
Ensembl: ENSMUSG00000048062
Vega: OTTMUSG00000039013
UniProt: A4FUQ5
Position
17; 17 A3.2
AA seq 323 aa
MEVNISMPLNGSEVVFYDSTTSRVLWILSLVVLFITFVLGVLGNGLVIWVAGFQMAHTVT
TVSYLNLALSDLSFMATLPLHIISMVMRGKWLFGWFLCKLVHIIANINLFVSIFLITLIA
MDRCICVLCPVWSQNHRTVSLARKVVLGAWIFALLLTLPHFLFLTTVRDARGDVYCISKF
ESWVATSEEQLKVSVIAATASGIINFIIGFSMPMSFIAICYGLMAAKICRRGFVNSSRPL
RVLTAVAVSFFVCWFPFQLIMLLGNIFNNETLSIIHMLVNPANTLASFNSCLNPILYVFL
GQEFRDRLIYSLYASLERALRED
NT seq 972 nt   +upstreamnt  +downstreamnt
atggaagtcaacatttcaatgcctctgaatggatcagaagttgtgttttatgattctacc
acctcaagagttctatggatcctctcattagtggttctctttataacctttgtcctcggt
gttctaggtaatgggcttgtgatttgggtggctgggttccagatggcacacactgtgacc
actgtctcttatctgaacttggctttgagtgatttatctttcatggctactctaccactt
cacatcatctcaatggtcatgagaggaaaatggctttttggttggtttctttgcaaatta
gttcacataattgcaaacataaacctttttgtaagtatcttcctaatcactcttattgcc
atggatcgctgtatttgtgtcctgtgcccagtatggtctcagaatcaccgaactgtgagt
ctggccagaaaagtggttcttggagcttggatatttgctctgctgcttaccttgccacat
tttctcttcttgactacagtgagagatgcaagaggggatgtgtactgtatatctaaattt
gaatcctgggttgcaacctctgaagagcagttaaaggtgtctgttattgctgccacagct
tcaggaatcatcaatttcattattggattcagcatgcccatgtctttcattgctatctgc
tatggactcatggctgccaagatctgcagaagaggctttgtgaattccagtcgtccttta
cgtgtcctcactgctgtagcagtttccttctttgtctgttggttcccttttcaattaatt
atgcttttaggcaacatctttaacaatgagacactgagcattattcatatgttggttaac
ccagcaaataccttggcttcctttaacagctgcctcaacccaatactctatgtattcctg
ggtcaggaattcagagacagactaatctattctctgtatgccagtctagagagggccctg
agggaagactag

KEGG   Mus musculus (mouse): 14294
Entry
14294             CDS       T01002                                 

Gene name
Fpr3, ALX, Fp, Fpr, Fpr-rs1, Fpr-s1, Fprl1, LXA, LXA4-R, Lx, Lxa4r
Definition
(RefSeq) formyl peptide receptor 3
  KO
K04173  formyl peptide receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04613  Neutrophil extracellular trap formation
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14294 (Fpr3)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    14294 (Fpr3)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14294 (Fpr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14294 (Fpr3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    14294 (Fpr3)
SSDB
Motif
Pfam: 7tm_1 DUF5867
Other DBs
NCBI-GeneID: 14294
NCBI-ProteinID: NP_032068
MGI: 1194495
Ensembl: ENSMUSG00000079700
Vega: OTTMUSG00000021780
UniProt: O08790
Position
17; 17 A3.2
AA seq 351 aa
METNYSIPLNGSDVVIYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVT
TIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIAVDVNLFGSVFLIAVIA
LDRCICVLHPVWAQNHRTVSLARNVVVGSWIFALILTLPLFLFLTTVRDARGDVHCRLSF
VSWGNSVEERLNTAITFVTTRGIIRFIVSFSLPMSFVAICYGLITTKIHKKAFVNSSRPF
RVLTGVVASFFICWFPFQLVALLGTVWLKEMQFSGSYKIIGRLVNPTSSLAFFNSCLNPI
LYVFMGQDFQERLIHSLSSRLQRALSEDSGHISDTRTNLASLPEDIEIKAI
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggaaaccaactactctatccctttgaatggatcagatgtggtgatctatgattctacc
atctccagggttctgtggatcctctcaatggtggttgtctccatcactttcttccttggt
gtgctgggaaatggactagtgatctgggtagctggattccggatgccacacactgtcacc
actatctggtatctgaatctagcattggctgacttctctttcacagcaactctaccattc
cttcttgttgaaatggctatgaaagaaaaatggccttttggctggttcctgtgtaaatta
gttcacattgcagtagatgtaaacctatttggaagtgtcttcttgattgctgtcattgcc
ttggaccgctgtatttgtgtcctgcatccagtctgggctcagaaccaccgcactgtgagc
ctggctagaaatgtggttgttgggtcctggatttttgctctcattctcactttgcccctt
ttcctcttcttgactacagttagagatgctagaggggatgtgcactgtagattgagcttt
gtatcctggggcaactctgttgaggaaaggttgaacacagctatcacgtttgtaacaact
agagggatcatcaggttcattgttagcttcagcttgcccatgtcctttgttgccatctgc
tatggactcatcactacaaagattcacaaaaaagcctttgttaattccagccgtcctttc
cgagttcttacaggagttgtggcttccttctttatctgttggtttcctttccaattggtg
gcccttttaggcacagtctggctcaaagagatgcagtttagtggtagttataaaattatt
ggcaggttggttaatccaaccagttcattggcctttttcaatagctgcctcaatccaatt
ctctatgttttcatgggccaggactttcaagaaagactgattcattccctgtcttctcgt
ctgcagagagccctgagtgaggactctggtcatatcagtgatacaagaaccaatttggct
tcacttcctgaagacattgaaataaaggcaatatga

KEGG   Mus musculus (mouse): 321020
Entry
321020            CDS       T01002                                 

Gene name
Fpr-rs6
Definition
(RefSeq) formyl peptide receptor, related sequence 6
  KO
K04173  formyl peptide receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04613  Neutrophil extracellular trap formation
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    321020 (Fpr-rs6)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    321020 (Fpr-rs6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    321020 (Fpr-rs6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    321020 (Fpr-rs6)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    321020 (Fpr-rs6)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 321020
NCBI-ProteinID: NP_796290
MGI: 2448176
Ensembl: ENSMUSG00000071275
Vega: OTTMUSG00000039772
UniProt: Q3SXG2
Position
17; 17 A3.2
AA seq 339 aa
MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVT
TICYLNLALSDFSYMASLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIA
MDRCICVLHPVWAQNHRTVNVATKVIFGAWILVLMLIFPHCIFVTTVKDESGKVHCICNF
ESWAATPEEQVKVSMTVSLISVTISFIIGFSIPMIFIVICYGLMAAKIGRRGFVNSSRPL
RVLTAVAISFFVCWFPFQLIFLLGNIGNKETQNNIDTWVNTASTLASFNSCLNPILYVFL
GQQFRERLIYSLSASLERALREDSALNSDKTRNLSSQRL
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggaagccaacttctccatacctcagaatggatcagaagtggtgttttatgattctacc
acctccagagttatatgtatcttcttagttgtggtcctctctataacctttctccttggt
gtgataggtaatgggcttgtgatttatgtggctgggttccggatgacacacactgtgaca
acaatctgttatctgaacctggcattgtctgacttctcttacatggcaagtctaccattt
cagatcacctcaattgtcatgaatggagaatggctttttggttggttcctttgcaaattt
gttcacatgattataaacgtaaacctttttctaagtatcttcttgattactttcattgcc
atggatcgttgtatttgtgttctgcatccagtatgggctcagaatcatcgaactgtgaat
gtggcaacgaaagtgatctttggagcttggatacttgttctgatgcttatatttccacat
tgtatcttcgtgactacagtgaaagatgaaagtgggaaagtacattgcatatgtaatttt
gaatcctgggctgcaacccctgaggagcaagtaaaagtatctatgactgtgagtttaatt
tcagtaaccatcagtttcattattggcttcagcataccaatgatcttcattgtcatctgt
tatggactcatggctgccaagataggcagaagaggttttgtgaattccagtcgtccttta
cgtgtcctcactgctgtagcaatttctttctttgtctgttggttcccttttcaattgatt
tttcttttaggcaatattgggaacaaggagacacagaataatattgacacgtgggtgaac
acagcaagcactctggcctccttcaatagttgcctcaacccaatactctatgttttccta
ggtcagcaattcagagagagactgatctactccctatcagctagtctggagagggccctg
agggaggactcagccctgaacagtgacaaaaccagaaacttgtcttcacaaagactctga

KEGG   Mus musculus (mouse): 321021
Entry
321021            CDS       T01002                                 

Gene name
Fpr-rs7
Definition
(RefSeq) formyl peptide receptor, related sequence 7
  KO
K04173  formyl peptide receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04613  Neutrophil extracellular trap formation
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    321021 (Fpr-rs7)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    321021 (Fpr-rs7)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    321021 (Fpr-rs7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    321021 (Fpr-rs7)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    321021 (Fpr-rs7)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 321021
NCBI-ProteinID: XP_030106054
MGI: 2448177
Ensembl: ENSMUSG00000071276
Vega: OTTMUSG00000039771
Position
17; 17 A3.2
AA seq 338 aa
MEANFSIPQNGSEVVFYDSTTSRVICIFLVVVLSITFLLGVIGNGLVIYVAGFRMTHTVT
TICYLNLALSDFSYMTSLPFQITSIVMNGEWLFGWFLCKFVHMIINVNLFLSIFLITFIA
MDRCICVLHPVWAQNHRTVNLARKVILGSWILVLMLIFPHFFFLTTVKDESGKVHCICNF
ESWAATPEEQVNMSMTVSLISVTLSFIVGFSIPMIFIVICYGLMAAKIGRRGLVNSSRPL
RVLTAVAFSFFVCWFPFQLIFLLGNIGNKETQNNIDAWVNPASTLASFNSCLNPILYVFL
GQQFRERLIYSLSASLERALREDSALNSDKIRNLSSQT
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggaagccaacttctccatacctcagaatggatcagaagtggtgttttatgattctacc
acatccagagttatatgtatcttcttagttgtggtcctctctataacctttctccttggt
gtgataggtaatgggcttgtgatttatgtggctgggttccggatgacacatactgtgaca
acaatctgttatctgaacctggcattgtctgacttctcttacatgacaagtctaccattt
cagatcacctcaattgtcatgaatggagaatggctttttggttggttcctttgcaaattt
gttcacatgattataaatgtaaacctttttctaagtatcttcttgattactttcattgcc
atggatcgctgtatttgtgttctgcatccagtatgggctcagaatcatcgaactgtgaat
ctggcaaggaaagtgattttgggatcttggatacttgttctgatgcttatatttccacat
tttttcttcttgactacagtgaaagatgaaagtggtaaagtacactgtatatgcaatttt
gaatcctgggctgcaacccctgaggagcaggtaaacatgtctatgactgtgagtttaatt
tcagtaaccctcagtttcattgttggcttcagcataccaatgatcttcattgtcatctgc
tatggactcatggctgccaagataggcagaagaggcttggtgaattccagtcgtccttta
cgtgtcctcactgctgtagcattttctttctttgtctgttggttcccttttcaattgatt
tttcttttaggcaatattgggaacaaggagacacagaataatattgacgcgtgggtgaac
ccagcaagcactctggcctccttcaatagttgcctcaacccaatactctatgttttccta
ggtcagcaattcagagagagactgatctactccctatcagctagtctggagagggccctg
agggaggattcagccctgaacagtgacaaaatcagaaacttgtcttcacaaacttaa

DBGET integrated database retrieval system