KEGG   Mus musculus (mouse): 14293Help
Entry
14293             CDS       T01002                                 

Gene name
Fpr1, FPR, LXA4R, fMLF-R
Definition
(RefSeq) formyl peptide receptor 1
  KO
K04172  formyl peptide receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04015  Rap1 signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    14293 (Fpr1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14293 (Fpr1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    14293 (Fpr1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14293 (Fpr1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    14293 (Fpr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 14293
NCBI-ProteinID: NP_038549
MGI: 107443
Ensembl: ENSMUSG00000045551
Vega: OTTMUSG00000021779
UniProt: P33766
Position
17 A3.2; 17 10.63 cM
AA seq 364 aa AA seqDB search
MDTNMSLLMNKSAVNLMNVSGSTQSVSAGYIVLDVFSYLIFAVTFVLGVLGNGLVIWVAG
FRMKHTVTTISYLNLAIADFCFTSTLPFYIASMVMGGHWPFGWFMCKFIYTVIDINLFGS
VFLIALIALDRCICVLHPVWAQNHRTVSLAKKVIIVPWICAFLLTLPVIIRLTTVPNSRL
GPGKTACTFDFSPWTKDPVEKRKVAVTMLTVRGIIRFIIGFSTPMSIVAICYGLITTKIH
RQGLIKSSRPLRVLSFVVAAFFLCWCPFQVVALISTIQVRERLKNMTPGIVTALKITSPL
AFFNSCLNPMLYVFMGQDFRERLIHSLPASLERALTEDSAQTSDTGTNLGTNSTSLSENT
LNAM
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggacaccaacatgtctctcctcatgaacaagtctgcagtgaacctcatgaatgtatct
gggagtactcaatcagtatctgctggctacatcgttctggatgtcttctcatatttgatc
tttgccgtcacatttgtccttggggttctgggcaacgggctcgtgatctgggtggctggt
ttccgcatgaaacacactgtcaccaccatctcttacttgaacttggccattgctgacttt
tgcttcacttccactttgccattttacattgccagcatggtcatgggaggacattggcca
tttggttggttcatgtgcaaattcatatatactgtaatagacataaacctatttggaagt
gtcttcctgattgccctcattgcactggaccgctgtatttgtgttctgcatccagtctgg
gctcagaaccaccgcactgtgagcctagccaagaaggtaatcatcgtaccctggatttgt
gcatttcttcttacattgccagttatcattcgtttgaccacagtccctaatagtagactt
ggaccagggaaaacagcctgtactttcgacttctccccctggaccaaagatcctgtagag
aagaggaaggtggccgtcaccatgctcactgtcagaggaatcatcaggttcatcattggg
ttcagcactcccatgtccattgttgccatttgctatgggttaataaccactaaaattcac
aggcagggcctgatcaaatccagccgtcctttgcgggttctctcctttgttgtggctgcc
tttttcctctgctggtgcccatttcaagtagtggccctcatatccacaatccaagtccgt
gaacggttgaagaacatgactccaggcattgtaactgctttgaaaatcacaagccccttg
gctttcttcaacagctgcctcaatccaatgctttatgtctttatgggccaggacttcaga
gaaagactaatccactctttacctgccagcctagagagggccctgactgaggactcagct
cagaccagtgatacaggcaccaatttggggaccaactctacttccctttctgaaaacact
ttaaatgcaatgtaa

DBGET integrated database retrieval system