KEGG   Mus musculus (mouse): 14294Help
Entry
14294             CDS       T01002                                 

Gene name
Fpr3, ALX, Fpr-rs1, Fpr-s1, Fprl1, LXA4-R, Lxa4r
Definition
(RefSeq) formyl peptide receptor 3
  KO
K04173  formyl peptide receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14294 (Fpr3)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05150 Staphylococcus aureus infection
    14294 (Fpr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14294 (Fpr3)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   fMet-Leu-Phe
    14294 (Fpr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 14294
NCBI-ProteinID: NP_032068
MGI: 1194495
Ensembl: ENSMUSG00000079700
Vega: OTTMUSG00000021780
UniProt: O08790
Position
17; 17 A3.2
AA seq 351 aa AA seqDB search
METNYSIPLNGSDVVIYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVT
TIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIAVDVNLFGSVFLIAVIA
LDRCICVLHPVWAQNHRTVSLARNVVVGSWIFALILTLPLFLFLTTVRDARGDVHCRLSF
VSWGNSVEERLNTAITFVTTRGIIRFIVSFSLPMSFVAICYGLITTKIHKKAFVNSSRPF
RVLTGVVASFFICWFPFQLVALLGTVWLKEMQFSGSYKIIGRLVNPTSSLAFFNSCLNPI
LYVFMGQDFQERLIHSLSSRLQRALSEDSGHISDTRTNLASLPEDIEIKAI
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccaactactctatccctttgaatggatcagatgtggtgatctatgattctacc
atctccagggttctgtggatcctctcaatggtggttgtctccatcactttcttccttggt
gtgctgggaaatggactagtgatctgggtagctggattccggatgccacacactgtcacc
actatctggtatctgaatctagcattggctgacttctctttcacagcaactctaccattc
cttcttgttgaaatggctatgaaagaaaaatggccttttggctggttcctgtgtaaatta
gttcacattgcagtagatgtaaacctatttggaagtgtcttcttgattgctgtcattgcc
ttggaccgctgtatttgtgtcctgcatccagtctgggctcagaaccaccgcactgtgagc
ctggctagaaatgtggttgttgggtcctggatttttgctctcattctcactttgcccctt
ttcctcttcttgactacagttagagatgctagaggggatgtgcactgtagattgagcttt
gtatcctggggcaactctgttgaggaaaggttgaacacagctatcacgtttgtaacaact
agagggatcatcaggttcattgttagcttcagcttgcccatgtcctttgttgccatctgc
tatggactcatcactacaaagattcacaaaaaagcctttgttaattccagccgtcctttc
cgagttcttacaggagttgtggcttccttctttatctgttggtttcctttccaattggtg
gcccttttaggcacagtctggctcaaagagatgcagtttagtggtagttataaaattatt
ggcaggttggttaatccaaccagttcattggcctttttcaatagctgcctcaatccaatt
ctctatgttttcatgggccaggactttcaagaaagactgattcattccctgtcttctcgt
ctgcagagagccctgagtgaggactctggtcatatcagtgatacaagaaccaatttggct
tcacttcctgaagacattgaaataaaggcaatatga

DBGET integrated database retrieval system