KEGG   Mus musculus (mouse): 142980
Entry
142980            CDS       T01002                                 

Gene name
Tlr3, AI957183
Definition
(RefSeq) toll-like receptor 3
  KO
K05401  toll-like receptor 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04217  Necroptosis
mmu04620  Toll-like receptor signaling pathway
mmu05160  Hepatitis C
mmu05161  Hepatitis B
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    142980 (Tlr3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    142980 (Tlr3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05161 Hepatitis B
    142980 (Tlr3)
   05160 Hepatitis C
    142980 (Tlr3)
   05171 Coronavirus disease - COVID-19
    142980 (Tlr3)
   05164 Influenza A
    142980 (Tlr3)
   05168 Herpes simplex virus 1 infection
    142980 (Tlr3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    142980 (Tlr3)
   05165 Human papillomavirus infection
    142980 (Tlr3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:mmu04054]
    142980 (Tlr3)
   04090 CD molecules [BR:mmu04090]
    142980 (Tlr3)
Pattern recognition receptors [BR:mmu04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   142980 (Tlr3)
CD molecules [BR:mmu04090]
 Proteins
  142980 (Tlr3)
SSDB
Motif
Pfam: LRR_8 LRR_4 LRR_5 Tlr3_TMD TIR LRR_1 TIR_2 LRR_9 LRR_6 LRRNT LRRCT
Other DBs
NCBI-GeneID: 142980
NCBI-ProteinID: NP_569054
MGI: 2156367
Ensembl: ENSMUSG00000031639
Vega: OTTMUSG00000061136
UniProt: Q99MB1
Structure
PDB: 
3CIG 3CIY

Position
8; 8 B1.1
AA seq 905 aa
MKGCSSYLMYSFGGLLSLWILLVSSTNQCTVRYNVADCSHLKLTHIPDDLPSNITVLNLT
HNQLRRLPPTNFTRYSQLAILDAGFNSISKLEPELCQILPLLKVLNLQHNELSQISDQTF
VFCTNLTELDLMSNSIHKIKSNPFKNQKNLIKLDLSHNGLSSTKLGTGVQLENLQELLLA
KNKILALRSEELEFLGNSSLRKLDLSSNPLKEFSPGCFQTIGKLFALLLNNAQLNPHLTE
KLCWELSNTSIQNLSLANNQLLATSESTFSGLKWTNLTQLDLSYNNLHDVGNGSFSYLPS
LRYLSLEYNNIQRLSPRSFYGLSNLRYLSLKRAFTKQSVSLASHPNIDDFSFQWLKYLEY
LNMDDNNIPSTKSNTFTGLVSLKYLSLSKTFTSLQTLTNETFVSLAHSPLLTLNLTKNHI
SKIANGTFSWLGQLRILDLGLNEIEQKLSGQEWRGLRNIFEIYLSYNKYLQLSTSSFALV
PSLQRLMLRRVALKNVDISPSPFRPLRNLTILDLSNNNIANINEDLLEGLENLEILDFQH
NNLARLWKRANPGGPVNFLKGLSHLHILNLESNGLDEIPVGVFKNLFELKSINLGLNNLN
KLEPFIFDDQTSLRSLNLQKNLITSVEKDVFGPPFQNLNSLDMRFNPFDCTCESISWFVN
WINQTHTNISELSTHYLCNTPHHYYGFPLKLFDTSSCKDSAPFELLFIISTSMLLVFILV
VLLIHIEGWRISFYWNVSVHRILGFKEIDTQAEQFEYTAYIIHAHKDRDWVWEHFSPMEE
QDQSLKFCLEERDFEAGVLGLEAIVNSIKRSRKIIFVITHHLLKDPLCRRFKVHHAVQQA
IEQNLDSIILIFLQNIPDYKLNHALCLRRGMFKSHCILNWPVQKERINAFHHKLQVALGS
RNSAH
NT seq 2718 nt   +upstreamnt  +downstreamnt
atgaaagggtgttcctcttatctaatgtactcctttgggggacttttgtccctatggatt
cttctggtgtcttccacaaaccaatgcactgtgagatacaacgtagctgactgcagccat
ttgaagctaacacacatacctgatgatcttccctctaacataacagtgttgaatcttact
cacaaccaactcagaagattaccacctaccaactttacaagatacagccaacttgctatc
ttggatgcaggatttaactccatttcaaaactggagccagaactgtgccaaatactccct
ttgttgaaagtattgaacctgcaacataatgagctctctcagatttctgatcaaaccttt
gtcttctgcacgaacctgacagaactcgatctaatgtctaactcaatacacaaaattaaa
agcaaccctttcaaaaaccagaagaatctaatcaaattagatttgtctcataatggttta
tcatctacaaagttgggaacgggggtccaactggagaacctccaagaactgctcttagca
aaaaataaaatccttgcgttgcgaagtgaagaacttgagtttcttggcaattcttcttta
cgaaagttggacttgtcatcaaatccacttaaagagttctccccggggtgtttccagaca
attggcaagttattcgccctcctcttgaacaacgcccaactgaacccccacctcacagag
aagctttgctgggaactttcaaacacaagcatccagaatctctctctggctaacaaccag
ctgctggccaccagcgagagcactttctctgggctgaagtggacaaatctcacccagctc
gatctttcctacaacaacctccatgatgtcggcaacggttccttctcctatctcccaagc
ctgaggtatctgtctctggagtacaacaatatacagcgtctgtcccctcgctctttttat
ggactctccaacctgaggtacctgagtttgaagcgagcatttactaagcaaagtgtttca
cttgcttcacatcccaacattgacgatttttcctttcaatggttaaaatatttggaatat
ctcaacatggatgacaataatattccaagtaccaaaagcaataccttcacgggattggtg
agtctgaagtacctaagtctttccaaaactttcacaagtttgcaaactttaacaaatgaa
acatttgtgtcacttgctcattctcccttgctcactctcaacttaacgaaaaatcacatc
tcaaaaatagcaaatggtactttctcttggttaggccaactcaggatacttgatctcggc
cttaatgaaattgaacaaaaactcagcggccaggaatggagaggtctgagaaatatattt
gagatctacctatcctataacaaatacctccaactgtctaccagttcctttgcattggtc
cccagccttcaaagactgatgctcaggagggtggcccttaaaaatgtggatatctcccct
tcacctttccgccctcttcgtaacttgaccattctggacttaagcaacaacaacatagcc
aacataaatgaggacttgctggagggtcttgagaatctagaaatcctggattttcagcac
aataacttagccaggctctggaaacgcgcaaaccccggtggtcccgttaatttcctgaag
gggctgtctcacctccacatcttgaatttagagtccaacggcttagatgaaatcccagtc
ggggttttcaagaacttattcgaactaaagagcatcaatctaggactgaataacttaaac
aaacttgaaccattcatttttgatgaccagacatctctaaggtcactgaacctccagaag
aacctcataacatctgttgagaaggatgttttcgggccgccttttcaaaacctgaacagt
ttagatatgcgcttcaatccgttcgactgcacgtgtgaaagtatttcctggtttgttaac
tggatcaaccagacccacactaatatctctgagctgtccactcactacctctgtaacact
ccacatcattattatggcttccccctgaagcttttcgatacatcatcctgtaaagacagc
gccccctttgaactcctcttcataatcagcaccagtatgctcctggtttttatacttgtg
gtactgctcattcacatcgagggctggaggatctctttttactggaatgtttcagtgcat
cggattcttggtttcaaggaaatagacacacaggctgagcagtttgaatatacagcctac
ataattcatgcccataaagacagagactgggtctgggaacatttctccccaatggaagaa
caagaccaatctctcaaattttgcctagaagaaagggactttgaagcaggcgtccttgga
cttgaagcaattgttaatagcatcaaaagaagccgaaaaatcattttcgttatcacacac
catttattaaaagaccctctgtgcagaagattcaaggtacatcacgcagttcagcaagct
attgagcaaaatctggattcaattatactgatttttctccagaatattccagattataaa
ctaaaccatgcactctgtttgcgaagaggaatgtttaaatctcattgcatcttgaactgg
ccagttcagaaagaacggataaatgcctttcatcataaattgcaagtagcacttggatct
cggaattcagcacattaa

DBGET integrated database retrieval system