KEGG   Mus musculus (mouse): 14308
Entry
14308             CDS       T01002                                 

Gene name
Fshb, FS, FSH, FSH-B, FSH-beta, Fshbe, Fshbeta
Definition
(RefSeq) follicle stimulating hormone beta
  KO
K05250  follitropin subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04912  GnRH signaling pathway
mmu04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    14308 (Fshb)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14308 (Fshb)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    14308 (Fshb)
   04913 Ovarian steroidogenesis
    14308 (Fshb)
SSDB
Motif
Pfam: Cys_knot
Other DBs
NCBI-GeneID: 14308
NCBI-ProteinID: NP_032071
MGI: 95582
Ensembl: ENSMUSG00000027120
Vega: OTTMUSG00000015038
UniProt: Q60687 A0A0F7RQR1
Position
2 E3; 2 56.02 cM
AA seq 130 aa
MMKLIQLCILFWCWRAICCHSCELTNITISVEKEECRFCISINTTWCAGYCYTRDLVYKD
PARPNTQKVCTFKELVYETVRLPGCARHSDSLYTYPVATECHCGKCDSDSTDCTVRGLGP
SYCSFSEMKE
NT seq 393 nt   +upstreamnt  +downstreamnt
atgatgaagttgatccagctttgcatcttattctggtgctggagagcaatctgctgccat
agctgtgaattgaccaacatcaccatctcagtagagaaggaagagtgccgtttctgcata
agcatcaataccacttggtgtgcgggctactgctacactagggatctggtgtataaggac
ccagctcggcccaatacccagaaagtatgtaccttcaaggagctggtatacgagaccgta
agattgcctggctgtgcccgccactcagactccctctacacatatccagtagccactgaa
tgtcactgtggcaagtgtgacagcgacagcactgactgcaccgtgaggggcctaggaccc
agctactgctccttcagtgaaatgaaggaataa

DBGET integrated database retrieval system