KEGG   Mus musculus (mouse): 14309
Entry
14309             CDS       T01002                                 

Gene name
Fshr
Definition
(RefSeq) follicle stimulating hormone receptor
  KO
K04247  follicle stimulating hormone receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    14309 (Fshr)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14309 (Fshr)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    14309 (Fshr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14309 (Fshr)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Peptide
   Follicle stimulating hormone (FSH)
    14309 (Fshr)
SSDB
Motif
Pfam: 7tm_1 GnHR_trans LRR_8 LRR_5 LRRNT LRR_4 LRR_9
Other DBs
NCBI-GeneID: 14309
NCBI-ProteinID: NP_038551
MGI: 95583
Ensembl: ENSMUSG00000032937
UniProt: P35378 B2RQM3
Position
17; 17 E5
AA seq 692 aa
MALLLVSLLAFLGSGSGCHHWLCHCSNRVFLCQDSKVTEIPPDLPRNAIELRFVLTKLRV
IPKGSFSGFGDLEKIEISQNDVLEVIEADVFSNLPNLHEIRIEKANNLLYINPEAFQNLP
SLRYLLISNTGIKHLPAFHKIQSLQKVLLDIQDNINIHIIARNSFMGLSFESVILWLNKN
GIQEIHNCAFNGTQLDELNLSDNNNLEELPDDVFQGASGPVVLDISRTKVYSLPNHGLEN
LKKLRARSTYRLKKLPSLDKFVMLIEASLTYPSHCCAFANWRRQTSELHPICNKSISRQD
IDDMTQPGDQRVSLVDDEPSYGKGSDMLYSEFDYDLCNEFVDVTCSPKPDAFNPCEDIMG
YNILRVLIWFISILAITGNTTVLVVLTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASV
DIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLAAITLERWHTITHAMQLECKV
QLCHAASIMVLGWAFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMALLVLNALA
FVVICGCYTHIYLTVRNPNIVSSSRDTKIAKRMATLIFTDFLCMAPILFFAISASLKVPL
ITVSKAKILLVLFYPINSCANPFLYAIFTKNFRRDFFVLMSKFGCYEVQAQIYKTETSSI
THNFHSRKNPCSSAPRVTNSYVLVPLNHSVQN
NT seq 2079 nt   +upstreamnt  +downstreamnt
atggccttgctcctggtctccttgctggcattcttgggctcgggatctggatgtcatcac
tggctgtgtcattgctctaacagggtcttcctctgccaagatagcaaggtgaccgagatt
ccgcccgacctcccccggaacgccattgaactgagatttgtgctcaccaagcttcgagtc
attccaaaaggatcattttctggatttggggacctggagaaaatagagatctctcagaat
gatgtcttggaggtaatagaggcagatgtgttctccaacctacccaacttgcatgaaatt
aggattgaaaaggctaacaatctgctgtacatcaaccctgaggccttccagaatcttccc
agtctccgatatctgttaatatccaacacaggcattaaacacttgccagcctttcacaag
atccagtctctccaaaaggttttattagacattcaagataacataaacatccacatcatt
gccaggaactccttcatgggactgagctttgaaagtgtaattctatggctgaataagaat
gggattcaagaaatacacaactgtgcattcaacggaacccagctagatgaactgaatcta
agcgataacaataatttggaagaattgcctgatgatgttttccagggagcctctgggcca
gtcgttttagacatctcaaggacaaaggtctattccctgcccaaccatggcttagaaaat
ctgaagaagttgagggccaggtcaacataccgcttgaaaaagctccctagtctagacaag
tttgtcatgctcattgaggccagccttacctaccccagtcactgctgtgcctttgcaaac
tggaggcggcaaacctctgaacttcatccaatttgcaacaagtctatttcaaggcaagat
attgatgatatgactcagcctggggatcagagagtctctctcgtagatgatgaacccagt
tatggaaaaggatctgacatgttgtatagtgaatttgactatgacttatgcaatgaattt
gttgatgtgacctgctcgccaaagccagatgcatttaatccatgtgaagacatcatgggg
tacaacatcctcagagtcttgatatggtttatcagcatcctggccatcactgggaacacc
acagtgctggtggtcctgaccacaagccaatacaaactcactgtgccccggttccttatg
tgtaacctcgcctttgctgatctttgcattgggatctacttgctacttatagcctcagtt
gatatccatactaagagccagtaccacaattacgccattgactggcaaacaggagcaggc
tgcgatgccgctggctttttcactgtctttgccagtgaactgtcagtctacacattggca
gccataaccctagaaagatggcataccatcacacatgccatgcaactggaatgcaaggta
cagctctgccatgctgccagcatcatggtgctgggctgggcctttgcctttgcggctgct
ctcttccccatctttggcatcagtagctacatgaaagtgagcatctgcctgcccatggat
atcgacagccctttgtcgcagctgtatgttatggccctcctcgtactcaacgccctggcc
tttgtggtcatctgtggttgctacacccacatctacctcacagtgaggaatcctaacatt
gtgtcctcgtcaagagacaccaagattgccaagcgcatggccacactcatcttcacggac
tttctctgcatggccccaattttattctttgccatttccgcctccctcaaggtgcccctc
atcactgtgtccaaggccaagatcctcctagttctgttctaccccatcaattcttgtgcc
aatcctttcctctatgccattttcaccaagaacttccgcagggacttcttcgtcctgatg
agcaagtttggctgttatgaggtgcaagcccagatttacaagacagaaacctcatctatt
acccacaacttccactccagaaagaatccctgttcctcggctcccagagtcaccaatagt
tacgtgcttgtccctctaaatcattcagtccagaactaa

DBGET integrated database retrieval system