KEGG   Mus musculus (mouse): 14317
Entry
14317             CDS       T01002                                 

Gene name
Ftcd
Definition
(RefSeq) formiminotransferase cyclodeaminase
  KO
K13990  glutamate formiminotransferase / formiminotetrahydrofolate cyclodeaminase [EC:2.1.2.5 4.3.1.4]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00340  Histidine metabolism
mmu00670  One carbon pool by folate
mmu01100  Metabolic pathways
Module
mmu_M00045  Histidine degradation, histidine => N-formiminoglutamate => glutamate
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    14317 (Ftcd)
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    14317 (Ftcd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    14317 (Ftcd)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14317 (Ftcd)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.5  glutamate formimidoyltransferase
     14317 (Ftcd)
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.4  formimidoyltetrahydrofolate cyclodeaminase
     14317 (Ftcd)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    14317 (Ftcd)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   14317 (Ftcd)
SSDB
Motif
Pfam: FTCD_N FTCD FTCD_C
Other DBs
NCBI-GeneID: 14317
NCBI-ProteinID: NP_543121
MGI: 1339962
Ensembl: ENSMUSG00000001155
Vega: OTTMUSG00000020446
UniProt: Q91XD4
Position
10 C1; 10 39.25 cM
AA seq 541 aa
MSQLVECVPNFSEGNNQEVIDAISRAISQTPGCVLLDVDAGPSTNRTVYTFVGQPECVVE
GALHAARTASQLIDMSKHKGEHPRMGALDVCPFIPVRGVSMEECVLCAKAFGQRLAEELN
VPVYLYGEAAQTPSRQTLPAIRAGEYEALPEKLKQAEWVPDFGPSSFVPSWGATVTGARK
FLIAFNINLLSTKEQAHRIALNLREQGRGKDQPGRLKKVQGIGWYLEEKNLAQVSTNLLD
FEVTALHTVFEEARREAQELNLPVVGSQLVGLVPLKALLDAAAFYCDKEKLFVLEEEHRI
RLVVNRLGLDSLAPFDPKERIIEYLVPDSGPEQSLLDTSLRGFVREVGARSAAPGGGSVA
AAVAALGAALASMVGQMTYGRRQFDHLDSTMRRLIPPFHAASAQLTSLVDADARAFAACL
EAIKLPKNTPEERDRRACALQEGLRQAVAVPLKLAETVSQLWPALQELAHCGNLSCLSDL
QVAAKALETGVFGAYFNVLINLKDMTDDVFKEKTHHRISSLLQEAKTQAALVLGSLEARK
E
NT seq 1626 nt   +upstreamnt  +downstreamnt
atgtctcagttggtggaatgtgtccccaacttctcagaggggaacaaccaggaggtgatt
gatgccatctctcgagccatctcccagaccccaggctgtgtgctgttggacgtcgatgcc
ggaccctccaccaaccgcactgtctacactttcgtggggcagccagagtgtgtcgtagag
ggggccctccatgctgcgcgtacggcctcacagctcatcgacatgagcaagcacaagggt
gagcaccctcgaatgggcgctctggatgtgtgtcccttcatcccggtgaggggcgtcagc
atggaagagtgtgtgctctgtgccaaggcatttgggcagcggctggcagaggaacttaat
gtaccagtgtatctctatggtgaggcagctcagacgcccagtcgtcagaccctgccagcc
atccgggctggagagtatgaggccctgcctgagaagctcaaacaggccgagtgggtgcca
gactttggccctagctcctttgtccccagttggggtgctactgtcacgggtgcacggaag
ttcctcattgcattcaatatcaacctgctaagcaccaaggagcaggcccaccgtattgct
cttaacctgcgggagcagggccgagggaaagaccagcctggacgtctgaaaaaggtccag
ggcatcggttggtacctggaagagaagaacctggctcaggtgtccacaaacctcctggac
tttgaggtcacagctctgcacacagtgtttgaggaggcccgcagagaggctcaggagctg
aatctcccagtggtgggctcgcagctggtgggcctggtgcctctgaaggccttactggat
gccgcagccttctactgtgacaaggagaagctgtttgttctggaggaggagcatcggata
cggctggtggtgaaccggctgggcctggattcgctggcacccttcgacccaaaggaacgg
atcatcgagtacctagtccccgatagtggaccagaacagagcctgttggacacctcactg
cgcggttttgttcgggaggtgggagcccgctctgctgccccaggaggaggttctgtagca
gcagcggtagcagctctgggtgcagccctggcttctatggtgggccagatgacctatggc
cggcgccagtttgatcacttggattccacaatgcgacgcctgatcccacccttccacgca
gcctctgcccagctgacttcattggtggatgctgatgcccgggcgtttgctgcctgtttg
gaggcaataaagctgcccaagaacacgcctgaagagagagacaggcgtgcatgcgctctg
caggaggggctgagacaggcagtcgctgtgccactgaaactggccgagactgtgtcccag
ctatggccagcgctgcaggagctggcccactgtgggaacctgtcctgcttgtctgacctg
caggtggcagccaaagccttggagacaggtgtgtttggtgcgtacttcaacgtgctcatc
aacctgaaggacatgacggatgatgtatttaaagagaagacacaccatcgaatctccagc
cttctgcaggaagccaagactcaggctgcgctggtgctgggtagcctagaagcccgaaag
gagtga

DBGET integrated database retrieval system