KEGG   Mus musculus (mouse): 14357
Entry
14357             CDS       T01002                                 

Gene name
Dtx1, Fxit1, mKIAA4160
Definition
(RefSeq) deltex 1, E3 ubiquitin ligase
  KO
K06058  deltex [EC:2.3.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    14357 (Dtx1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:mmu04121]
    14357 (Dtx1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     14357 (Dtx1)
Ubiquitin system [BR:mmu04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    14357 (Dtx1)
SSDB
Motif
Pfam: DTC WWE zf-C3HC4 zf-rbx1 zf-RING_2 zf-RING_5 zf-RING_UBOX zf-UDP zf-ANAPC11
Other DBs
NCBI-GeneID: 14357
NCBI-ProteinID: NP_032078
MGI: 1352744
Ensembl: ENSMUSG00000029603
Vega: OTTMUSG00000025278
UniProt: Q61010
Position
5 F; 5 60.64 cM
AA seq 627 aa
MSRPGQGVMVPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIENVLKEDARGSV
VLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPSSAPGKGIVWEWENDGGAWTA
YDMDICITIQNAYEKQHPWLDLSSLGFCYLIYFNSMSQMNRQTRRRRRLRRRLDLAYPLT
VGSIPKSQSWPVGASSGQPCSCQQCLLVNSTRAASNAILASQRRKAPIAPAAPPAPPPPP
PPLPPGGPPGALVVRPSATFAGAALWAAPATGPTEPAPPPGVPPRSPSAPNGAPTPGQNN
LSRPGPQRSTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCLTRA
PKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYMQKVKNPPDEDCTI
CMERLVTASGYEGVLRNKSVRPELVGRLGRCGHMYHLLCLVAMYSNGNKDGSLQCPTCKA
IYGEKTGTQPPGKMEFHLIPHSLPGFADTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFP
RHCYLPNNEKGRKVLRLLITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGH
GYPDASYLDNVLAELTAQGVSEAMAKA
NT seq 1884 nt   +upstreamnt  +downstreamnt
atgtcacggccaggccaaggtgtgatggtgccggtgaacgggctgggcttcccgccgcag
aacgtggccagggtggtggtgtgggagtggctcaatgagcacagccgctggcgaccctac
acggccaccgtgtgccaccacatcgagaatgttcttaaggaggatgcccggggctctgtg
gtccttggccaggtggacgcccagctggtgccctacatcatcgacctacaatccatgcat
cagttccggcaagacacaggtaccatgcggccggtgcgacgcaacttctacgatccatcg
tcggcgccgggcaagggcatcgtgtgggaatgggagaacgacggcggggcgtggacggcc
tacgacatggacatctgcatcaccatccagaacgcgtacgagaagcagcacccgtggctc
gacctctcatcgctcggcttctgctacctcatctacttcaacagcatgtcccagatgaac
cgccagacgcgccgccgccgccgcctgcgccgtcgcctggacctggcttacccgctcact
gtcggctccattcccaagtcgcaatcctggcccgtgggagccagctcgggtcagccctgc
tcctgtcagcagtgcctgctggtcaacagcacgcgcgccgcctccaacgccatcctggcc
tcgcagcgccgcaaggctcccattgcgccagccgcgcctccagcgccccctccgcccccg
ccgccgctgccacccggaggacctccgggtgcgctcgttgtgcgccccagcgccactttc
gccggagctgcgctctgggccgcacctgccaccggccccacggagcctgcgccgcctcca
ggagttcccccaaggagccctagtgcccccaacggagcgcccacaccgggccaaaacaac
ctcagtcgaccaggaccacagaggtccaccagcgtcagcgcacgcgcctctatcccgcct
ggggttccggcgctccccgtgaagaacttgaatggcactggccctgtccacccagccttg
gcagggatgaccgggatcctgctgtgtgcagcggggctgccggtgtgcctgacacgagca
cccaaacccatcctgcacccaccaccagtaagcaaaagcgacgtgaagcctgtgcctgga
gtgcccggcgtgtgccgcaagaccaagaagaaacacctcaagaaaagcaagaatcctgag
gatgtggttcggaggtacatgcagaaggtgaaaaacccgcctgatgaggactgtaccatt
tgcatggagcggctggtcacagcatctggctatgagggcgtgctccgaaacaagagtgtg
cggcccgagcttgtgggccgcctgggccgctgcggccacatgtatcacctgctctgcctg
gtggccatgtactccaatggcaacaaggatggcagcctgcagtgtccaacctgcaaagcc
atctacggggagaagacagggacacagccaccagggaagatggagtttcacctcatcccg
cactcgctgcctggttttgcagacacccagacgatccgcatcgtctatgacatccccacg
ggcatccagggccctgaacatcccaacccaggcaagaagttcacagccagaggcttccct
cgccactgctacctacccaacaatgagaagggccgaaaggtgctgagattgctcatcacc
gcctgggaacgcagactcatcttcactatcggaacatccaacaccacgggcgagtcggac
accgtggtgtggaacgagattcaccacaagacggagtttggttccaacctcactggtcac
ggctaccccgacgccagctacctagacaacgtgctggctgagctcaccgcccagggggtt
tctgaggccatggccaaggcctga

DBGET integrated database retrieval system