KEGG   Mus musculus (mouse): 14360
Entry
14360             CDS       T01002                                 

Gene name
Fyn, AI448320, AW552119
Definition
(RefSeq) Fyn proto-oncogene
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04360  Axon guidance
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04520  Adherens junction
mmu04611  Platelet activation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04725  Cholinergic synapse
mmu05020  Prion disease
mmu05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    14360 (Fyn)
   04071 Sphingolipid signaling pathway
    14360 (Fyn)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    14360 (Fyn)
   04520 Adherens junction
    14360 (Fyn)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    14360 (Fyn)
   04650 Natural killer cell mediated cytotoxicity
    14360 (Fyn)
   04660 T cell receptor signaling pathway
    14360 (Fyn)
   04664 Fc epsilon RI signaling pathway
    14360 (Fyn)
  09156 Nervous system
   04725 Cholinergic synapse
    14360 (Fyn)
  09158 Development and regeneration
   04360 Axon guidance
    14360 (Fyn)
   04380 Osteoclast differentiation
    14360 (Fyn)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    14360 (Fyn)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    14360 (Fyn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    14360 (Fyn)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14360 (Fyn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     14360 (Fyn)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   14360 (Fyn)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    14360 (Fyn)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    14360 (Fyn)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 SH3_3 ABC1 zf-RING_14 Haspin_kinase
Other DBs
NCBI-GeneID: 14360
NCBI-ProteinID: NP_001116365
MGI: 95602
Ensembl: ENSMUSG00000019843
Vega: OTTMUSG00000034130
UniProt: P39688
Structure
PDB: 
3UF4

Position
10 B1; 10 20.51 cM
AA seq 537 aa
MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcagcgaaactgacagaggagagggacggc
agcctgaaccagagctctgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggcgtgacctccatcccgaactacaacaacttccacgcagctgggggccaggga
ctcaccgtctttgggggtgtgaactcctcctctcacactgggaccctacgcacgagagga
gggacaggagtgacactgtttgtggcgctttatgactatgaagcacggacggaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagactggtgg
gaagcccgctccttgacaaccggggaaactggttacattcccagcaattacgtggctcca
gttgactccatccaggcagaagagtggtactttggaaaacttggccgcaaagatgctgag
agacagctcctgtcctttggaaacccaagaggtacctttcttatccgcgagagcgaaacc
accaaaggtgcctactcactttccatccgtgattgggatgatatgaaaggggaccacgtc
aaacattataaaatccgcaagcttgacaatggtggatactatatcacaacgcgggcccag
tttgaaacacttcagcaactggtacagcattactcagagagagccgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaatacaaaagtagccataaagacc
cttaagccaggcaccatgtctccggagtccttcctggaggaggcgcagatcatgaagaag
ctgaagcatgacaagctggtgcagctctacgcggtcgtgtctgaggagcccatttacatc
gtcacggagtacatgagcaaaggaagtttgcttgacttcttaaaagatggtgaaggaaga
gctctgaagttgccaaaccttgtggacatggcggcacaggttgctgcaggaatggcttac
atcgagcgcatgaattatatccacagagatctgcgatcagcaaacattctagtggggaat
ggactaatttgcaagattgctgactttggattggctcggttgattgaagacaatgaatac
acagcaagacaaggtgcgaagtttcccattaagtggacagcccccgaagcggccctgtat
ggaaggttcacaatcaagtctgacgtatggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggag
agaggctataggatgccctgcccacaggactgcccgatctccctgcacgagctcatgatc
cactgctggaaaaaggatccggaagagcgcccgaccttcgagtacttgcagggcttcctg
gaggactactttacggccacagagccccagtatcagcccggtgaaaacctgtga

KEGG   Mus musculus (mouse): 16818
Entry
16818             CDS       T01002                                 

Gene name
Lck, Hck-3, Lsk, Lskt, p56<lc, p56<lck>, p56Lck
Definition
(RefSeq) lymphocyte protein tyrosine kinase
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04064  NF-kappa B signaling pathway
mmu04380  Osteoclast differentiation
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu05135  Yersinia infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    16818 (Lck)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    16818 (Lck)
   04660 T cell receptor signaling pathway
    16818 (Lck)
   04658 Th1 and Th2 cell differentiation
    16818 (Lck)
   04659 Th17 cell differentiation
    16818 (Lck)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    16818 (Lck)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    16818 (Lck)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    16818 (Lck)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    16818 (Lck)
  09163 Immune disease
   05340 Primary immunodeficiency
    16818 (Lck)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    16818 (Lck)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mmu03036]
    16818 (Lck)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     16818 (Lck)
Protein kinases [BR:mmu01001]
 Non-receptor tyrosine kinases
  SRC family
   16818 (Lck)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    16818 (Lck)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 SH3_1 SH3_2 SH3_9 ABC1 Haspin_kinase Kdo SH3_16
Other DBs
NCBI-GeneID: 16818
NCBI-ProteinID: NP_001155905
MGI: 96756
Ensembl: ENSMUSG00000000409
Vega: OTTMUSG00000009667
UniProt: P06240
Position
4 D2.2; 4 63.26 cM
AA seq 509 aa
MGCVCSSNPEDDWMENIDVCENCHYPIVPLDSKISLPIRNGSEVRDPLVTYEGSLPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHDLVRHYTNASDGLCTKLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHPRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLNVNKLLDMAAQIAEGMAFIEEQNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEDRPTFDYLRSVLDDFFTATEGQYQPQP
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggctgtgtctgcagctcaaaccctgaagatgactggatggagaacattgacgtgtgt
gaaaactgccactatcccatagtcccactggacagcaagatctcgctgcccatccggaat
ggctctgaagtgcgggacccactggtcacctatgagggatctctcccaccagcatccccg
ctgcaagacaacctggttatcgccctgcacagttatgagccctcccatgatggagacttg
ggctttgagaagggtgaacagctccgaatcctggagcagagcggtgagtggtggaaggct
cagtccctgacgactggccaagaaggcttcattcccttcaacttcgtggcgaaagcaaac
agcctggagcctgaaccttggttcttcaagaatctgagccgtaaggacgccgagcggcag
cttttggcgcccgggaacacgcatggatccttcctgatccgggaaagcgaaagcactgcg
gggtccttttccctgtcggtcagagacttcgaccagaaccagggagaagtggtgaaacat
tacaagatccgtaacctagacaacggtggcttctacatctcccctcgtatcacttttccc
ggattgcacgatctagtccgccattacaccaacgcctctgatgggctgtgcacaaagttg
agccgtccttgccagacccagaagccccagaaaccatggtgggaggacgaatgggaagtt
cccagggaaacactgaagttggtggagcggctgggagctggccagttcggggaagtgtgg
atggggtactacaacggacacacgaaggtggcggtgaagagtctgaaacaagggagcatg
tcccccgacgccttcctggctgaggctaacctcatgaagcagctgcagcacccgcggcta
gtccggctttatgcagtggtcacccaggaacccatctacatcatcacggaatacatggag
aacgggagcctagtagattttctcaagactccctcgggcatcaagttgaatgtcaacaaa
cttttggacatggcagcccagattgcagagggcatggcgttcatcgaagaacagaattac
atccatcgggacctgcgcgccgccaacatcctggtgtctgacacgctgagctgcaagatt
gcagactttggcctggcgcgcctcattgaggacaatgagtacacggcccgggagggggcc
aaatttcccattaagtggacagcaccagaagccattaactatgggaccttcaccatcaag
tcagacgtgtggtccttcgggatcttgcttacagagatcgtcacccacggtcgaatccct
tacccaggaatgaccaaccctgaagtcattcagaacctggagagaggctaccgcatggtg
agacctgacaactgtccggaagagctgtaccacctcatgatgctgtgctggaaggagcgc
ccagaggaccggcccacgtttgactaccttcggagtgttctggatgacttcttcacagcc
acagagggccagtaccagccccagccttga

DBGET integrated database retrieval system