KEGG   Mus musculus (mouse): 14365
Entry
14365             CDS       T01002                                 

Gene name
Fzd3, AU020229, D930050A07Rik, Fz3
Definition
(RefSeq) frizzled class receptor 3
  KO
K02329  frizzled 3
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05206  MicroRNAs in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14365 (Fzd3)
   04390 Hippo signaling pathway
    14365 (Fzd3)
   04150 mTOR signaling pathway
    14365 (Fzd3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14365 (Fzd3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14365 (Fzd3)
  09158 Development and regeneration
   04360 Axon guidance
    14365 (Fzd3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14365 (Fzd3)
   05206 MicroRNAs in cancer
    14365 (Fzd3)
   05205 Proteoglycans in cancer
    14365 (Fzd3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14365 (Fzd3)
   05226 Gastric cancer
    14365 (Fzd3)
   05217 Basal cell carcinoma
    14365 (Fzd3)
   05224 Breast cancer
    14365 (Fzd3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    14365 (Fzd3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14365 (Fzd3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14365 (Fzd3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14365 (Fzd3)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14365 (Fzd3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 14365
NCBI-ProteinID: NP_067433
MGI: 108476
Ensembl: ENSMUSG00000007989
Vega: OTTMUSG00000020983
UniProt: Q61086
Position
14 D1; 14 34.09 cM
AA seq 666 aa
MAVSWIVFDLWLLTVFLGQIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLVGDPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASSPAQYKASTVTQGSHNKACTMLFMVLYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQAYRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSIFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSVHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctgtgagctggattgtctttgatctttggctcttgactgtgtttctggggcagata
ggtgggcacagtttgttttcttgtgaacctataaccttgaggatgtgccaagatttgcct
tacaatactaccttcatgcctaatcttctgaaccattatgaccaacagactgcagcttta
gcaatggagcccttccaccctatggtgaacctggattgttctcgggattttcggccattt
ctttgtgcactctatgcccctatttgtatggaatatggacgtgtcacacttccctgccgt
aggctgtgtcagcgtgcctatagcgagtgttcaaaactcatggagatgtttggtgtcccg
tggcctgaagatatggagtgcagtaggtttccagattgtgatgagccatatccccgactt
gtggatttgaatttagttggagatccaactgaaggagccccagttgcagtgcagagggac
tatggtttttggtgtcccagagagttaaaaattgatcctgatcttggctattcctttctg
cacgtgcgagattgttcgccaccatgtcccaatatgtacttcaggagagaagaactgtca
tttgctcgctatttcataggcctgatttcaatcatttgcctctctgccacattgtttact
tttttaacctttctaattgacgtcacaagattccgttaccctgaaagacctatcatattt
tatgcagtctgctacatgatggtgtcattaattttcttcattgggtttttgctggaggac
cgagtagcctgcaatgcatctagccctgcacagtataaggcttctacagtgacacaagga
tctcacaataaggcctgtaccatgctctttatggtactatattttttcactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggc
agtgaagctattgagaagaaagcattgctgtttcatgccagtgcctggggcatccccgga
actctaactatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgtcggcctctacgacgttgatgcattaagatatttcgttctcgctcccctctgc
ctgtatgtggtagttggggtttctctccttttagccggcattatatccctaaacagagtt
cggattgagatcccattagaaaaggaaaaccaagataagttagtgaagttcatgatccgg
attggtgttttcagcattctctaccttgtgccactcttggttgtaattggatgttacttt
tatgagcaagcttaccgcggcatctgggagacaacatggatccaggaacgctgcagagag
tatcacattccatgtccgtaccaggttactcagatgagtcgtccagacctgattctcttt
ctgatgaagtatctcatggctctcatagttgggattccctctatattttgggttggaagc
aaaaagacatgctttgaatgggccagttttttccatgggcgtaggaaaaaagagatagtg
aatgagagccggcaggtgctccaggaacctgactttgctcagtcactcctgagggaccca
aatactccaattataagaaaatcaagaggaacttccactcaagggacatccacacatgct
tcttcaactcagctggccatggtggatgaccaaagaagcaaagcagggagtgtccacagc
aaagtgagcagctaccatggcagcctccacaggtcacgggatggcaggtacactccctgc
agttaccgaggaatggaggagagactacctcacggcagcatgtcacggctgacggatcat
tccaggcacagtagttctcatcggctcaacgagcagtcccgacacagcagcatccgagac
ctcagtaacaaccccatgactcacattacacatggcaccagcatgaaccgtgttattgag
gaggatggaaccagtgcttag

DBGET integrated database retrieval system