KEGG   Mus musculus (mouse): 14366
Entry
14366             CDS       T01002                                 

Gene name
Fzd4, Fz4
Definition
(RefSeq) frizzled class receptor 4
  KO
K02354  frizzled 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing syndrome
mmu05010  Alzheimer disease
mmu05165  Human papillomavirus infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    14366 (Fzd4)
   04390 Hippo signaling pathway
    14366 (Fzd4)
   04150 mTOR signaling pathway
    14366 (Fzd4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14366 (Fzd4)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    14366 (Fzd4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    14366 (Fzd4)
   05205 Proteoglycans in cancer
    14366 (Fzd4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14366 (Fzd4)
   05226 Gastric cancer
    14366 (Fzd4)
   05217 Basal cell carcinoma
    14366 (Fzd4)
   05224 Breast cancer
    14366 (Fzd4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    14366 (Fzd4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    14366 (Fzd4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    14366 (Fzd4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    14366 (Fzd4)
   04090 CD molecules [BR:mmu04090]
    14366 (Fzd4)
G protein-coupled receptors [BR:mmu04030]
 Frizzled / Smoothened family
  14366 (Fzd4)
CD molecules [BR:mmu04090]
 Proteins
  14366 (Fzd4)
SSDB
Motif
Pfam: Frizzled Fz Chol_subst-bind
Other DBs
NCBI-GeneID: 14366
NCBI-ProteinID: NP_032081
MGI: 108520
Ensembl: ENSMUSG00000049791
Vega: OTTMUSG00000059643
UniProt: Q61088 Q8BKU9 Q8BLL2 Q3V1B2
Position
7 D3; 7 49.32 cM
AA seq 537 aa
MAWPGTGPSSRGAPGGVGLRLGLLLQFLLLLRPTLGFGDEEERRCDPIRIAMCQNLGYNV
TKMPNLVGHELQTDAELQLTTFTPLIQYGCSSQLQFFLCSVYVPMCTEKINIPIGPCGGM
CLSVKRRCEPVLREFGFAWPDTLNCSKFPPQNDHNHMCMEGPGDEEVPLPHKTPIQPGEE
CHSVGSNSDQYIWVKRSLNCVLKCGYDAGLYSRSAKEFTDIWMAVWASLCFISTTFTVLT
FLIDSSRFSYPERPIIFLSMCYNIYSIAYIVRLTVGRERISCDFEEAAEPVLIQEGLKNT
GCAIIFLLMYFFGMASSIWWVILTLTWFLAAGLKWGHEAIEMHSSYFHIAAWAIPAVKTI
VILIMRLVDADELTGLCYVGNQNLDALTGFVVAPLFTYLVIGTLFIAAGLVALFKIRSNL
QKDGTKTDKLERLMVKIGVFSVLYTVPATCVIACYFYEISNWALFRYSADDSNMAVEMLK
IFMSLLVGITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGNETVV
NT seq 1614 nt   +upstreamnt  +downstreamnt
atggcctggccgggcacagggccgagcagccggggggcgcctggaggcgtcgggctcagg
ctggggctgctgctgcagttcctcctgctcctgcggccgacactggggttcggggacgag
gaggagcggcgctgcgaccccatccgcatcgccatgtgccagaacctcggctacaacgtg
accaagatgcccaacttagtgggacacgagctgcagacagacgccgagctgcagctgaca
actttcacgccgctcatccagtacggctgctccagccagctgcagttcttcctttgttcg
gtttatgtgccaatgtgcacagagaagatcaacatccccatcggcccgtgcggtggcatg
tgcctttcagtcaagagacgctgtgaaccagtcctgagagaatttgggtttgcctggccc
gacaccctgaactgcagcaagttcccgccccagaacgaccacaaccacatgtgcatggaa
ggaccaggtgatgaagaggttcccttgccccacaagactcccatccagcccggggaagag
tgccactccgtgggaagcaattctgatcagtacatctgggtgaagaggagcctgaactgt
gttctcaagtgtggctacgatgctggcttgtacagccgctcagctaaggagttcacggat
atttggatggctgtgtgggccagcctctgcttcatctccaccaccttcaccgtgctgacc
ttcctgattgattcatccaggttttcttaccctgagcgccccatcatatttctcagtatg
tgctataatatttatagcattgcttatattgttcggctgactgtaggccgggaaaggata
tcctgtgattttgaagaggcggcagagcccgttctcatccaagaaggacttaagaacaca
ggatgtgcaataattttcttgctgatgtacttttttggaatggccagctccatttggtgg
gttattctgacactcacttggtttttggcagccggactcaagtggggtcatgaagccatt
gaaatgcacagttcttatttccacatcgcagcctgggctattcccgcagtgaaaaccatt
gtcatcttgattatgagactagtggatgccgatgaactgactggcttgtgctatgttggg
aaccaaaatctagatgccctcactggctttgtggtggctcctctctttacgtatttggtg
attggaacgctgttcattgcggcgggtttggtggccttattcaaaatccggtccaatctt
caaaaagacgggacaaagacagacaagttggaaaggctaatggtcaagatcggggtcttc
tcagtactgtacacggttcctgcaacctgtgtgattgcctgttatttctatgaaatctca
aactgggcactctttcgatattctgcagatgactcaaacatggcagttgaaatgttgaaa
atttttatgtctttgctcgtgggcatcacttcaggcatgtggatttggtctgccaaaact
cttcacacgtggcaaaagtgttctaaccgattggtgaattctgggaaggtaaagagagag
aagagggggaatggttgggtgaagccaggaaaaggcaacgagactgtggtataa

DBGET integrated database retrieval system