KEGG   Mus musculus (mouse): 14373
Entry
14373             CDS       T01002                                 

Gene name
G0s2, AI255151, AV006465
Definition
(RefSeq) G0/G1 switch gene 2
Organism
mmu  Mus musculus (mouse)
Motif
Pfam: G0-G1_switch_2 HILPDA
Other DBs
NCBI-GeneID: 14373
NCBI-ProteinID: NP_032085
MGI: 1316737
Ensembl: ENSMUSG00000009633
Vega: OTTMUSG00000050857
UniProt: Q61585 Q545U0
Position
1 H6; 1 97.69 cM
AA seq 103 aa
MESVQELIPLAKEMMAQKPRGKLVKLYVLGSVLALFGVVLGLVETVCSPFTAASRLRDQE
AAVVELREACEQQSLHKQALLAGGKAQEATLCSRALSLRQHAS
NT seq 312 nt   +upstreamnt  +downstreamnt
atggaaagtgtgcaggagctgatccctctggccaaggagatgatggcgcagaagccccga
gggaagctagtgaagctatacgtgctgggcagtgtgctggcgctcttcggtgtggtgctc
ggcctagttgagacggtgtgcagccctttcacagccgccagccgtctgcgcgaccaagag
gctgcagtggtggagctgcgggaagcgtgtgaacagcagtccctccacaagcaggccctg
ctggcaggaggcaaggcacaggaggcgaccctgtgcagccgggccctgtccctccggcag
cacgcctcttaa

DBGET integrated database retrieval system