KEGG   Mus musculus (mouse): 14376
Entry
14376             CDS       T01002                                 

Gene name
Ganab, AU042638, G2, G2an, Gl, GluII, mKIAA0088
Definition
(RefSeq) alpha glucosidase 2 alpha neutral subunit
  KO
K05546  mannosyl-oligosaccharide alpha-1,3-glucosidase [EC:3.2.1.207]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00510  N-Glycan biosynthesis
mmu01100  Metabolic pathways
mmu04141  Protein processing in endoplasmic reticulum
Module
mmu_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    14376 (Ganab)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    14376 (Ganab)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.207  mannosyl-oligosaccharide alpha-1,3-glucosidase
     14376 (Ganab)
SSDB
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Other DBs
NCBI-GeneID: 14376
NCBI-ProteinID: NP_001280550
MGI: 1097667
Ensembl: ENSMUSG00000071650
UniProt: Q8BHN3
Structure
PDB: 

Position
19; 19 A
AA seq 944 aa
MAAIAAVAARRRRSWLSLVLAYLGVCLGITLAVDRSNFKTCDESSFCKRQRSIRPGLSPY
RALLDTLQLGPDALTVHLIHEVTKVLLVLELQGLQKNMTRIRIDELEPRRPRYRVPDVLV
ADPPTARLSVSGRDDNSVELTVAEGPYKIILTAQPFRLDLLEDRSLLLSVNARGLMAFEH
QRAPRVPQESKDPAEGNGAQPEATPGDGDKPEETQEKAEKDEPGAWEETFKTHSDSKPYG
PTSVGLDFSLPGMEHVYGIPEHADSLRLKVTEGGEPYRLYNLDVFQYELNNPMALYGSVP
VLLAHSFHRDLGIFWLNAAETWVDISSNTAGKTLFGKMLDYLQGSGETPQTDIRWMSESG
IIDVFLMLGPSVFDVFRQYASLTGTQALPPLFSLGYHQSRWNYRDEADVLEVDQGFDDHN
MPCDVIWLDIEHADGKRYFTWDPTRFPQPLNMLEHLASKRRKLVAIVDPHIKVDSGYRVH
EELRNHGLYVKTRDGSDYEGWCWPGSASYPDFTNPRMRAWWSNMFSFDNYEGSAPNLYVW
NDMNEPSVFNGPEVTMLKDAVHYGGWEHRDIHNIYGLYVHMATADGLIQRSGGIERPFVL
SRAFFSGSQRFGAVWTGDNTAEWDHLKISIPMCLSLALVGLSFCGADVGGFFKNPEPELL
VRWYQMGAYQPFFRAHAHLDTGRREPWLLASQYQDAIRDALFQRYSLLPFWYTLFYQAHK
EGFPVMRPLWVQYPEDMSTFSIEDQFMLGDALLIHPVSDAGAHGVQVYLPGQEEVWYDIQ
SYQKHHGPQTLYLPVTLSSIPVFQRGGTIVPRWMRVRRSSDCMKDDPITLFVALSPQGTA
QGELFLDDGHTFNYQTRHEFLLRRFSFSGSTLVSSSADPKGHLETPIWIERVVIMGAGKP
AAVVLQTKGSPESRLSFQHDPETSVLILRKPGVSVASDWSIHLR
NT seq 2835 nt   +upstreamnt  +downstreamnt
atggcggcaatagcggcagtggcggcgcgtaggaggcggtcttggttaagtttggtgctg
gcatacttaggggtctgtctggggattacacttgctgtggatagaagcaactttaagacc
tgtgatgagagttccttttgcaaacggcagcgaagcattcggccaggcctctctccttac
cgtgccttgctggacactctgcagcttggtcctgatgctcttacagtccatctgatccat
gaagtcaccaaggtgctgcttgtgctggagctccagggccttcagaagaacatgactcgg
atcaggatcgatgagctagagccccggcggcctcgataccgagtgccagatgttttagtg
gctgacccccccacagctaggctttcagtctctggccgtgatgacaacagtgtggagcta
acagtggctgagggaccctacaaaatcattttgacagcacagccattccgccttgacctg
ctagaagatcgaagcctcctgctcagtgtcaatgcccgaggacttatggcctttgagcac
cagagggcccccagggtcccgcaagaatcaaaagacccagctgaaggcaatggagcccag
cctgaagcaacacctggggatggtgacaagccagaggagacccaggaaaaggctgagaag
gatgagccaggagcctgggaggagacattcaaaacacattctgacagcaagccttatggc
cccacgtctgtaggtttggacttttctctgccaggaatggaacatgtgtatgggatccct
gagcatgctgacagcctgagactgaaggtcactgagggcggtgagccgtaccgcctgtac
aatttggatgtgttccagtatgagctgaacaaccccatggctctatatgggtctgtgcct
gtgctcctggcacacagctttcatcgagacctgggcatcttctggcttaatgctgctgag
acttgggttgatatatcctccaacacggctgggaagaccctgtttgggaagatgcttgat
tacctgcagggctctggggagactccacagacagacattcgttggatgtcagagagtggc
attattgatgttttcctaatgcttggcccttcggtttttgatgtctttaggcagtatgct
agtctcacagggacccaggcattgcccccactcttctccctcggctatcaccagagtcgc
tggaactaccgggatgaggctgatgttttggaagtggatcagggttttgatgatcacaac
atgccttgtgatgtcatttggttggacattgaacatgctgatggcaagcggtacttcact
tgggaccccacccgatttcctcagcccctcaatatgcttgagcacttggcttccaagagg
cggaagctggtggccattgtggacccccacatcaaggtagactctggctaccgagttcac
gaagaattgcgaaaccatgggctgtatgttaaaactcgggatggctctgattacgagggc
tggtgctggccaggctcagctagttaccctgacttcactaatccaaggatgagggcctgg
tggtctaacatgttcagctttgacaattatgagggttcagctcctaatctttatgtttgg
aatgacatgaatgaaccgtctgtgttcaatggtcctgaggtcaccatgttgaaggatgct
gtgcattatggaggctgggagcaccgggacatccataacatctatggcttatatgtgcac
atggcgactgctgatgggctaatacagcgctctgggggcatagagcgtccctttgtcctg
agtagggctttcttctcaggctcccagcgctttggagctgtgtggacaggggacaacact
gccgaatgggatcatttgaagatctctatccctatgtgtctcagcctggcactggtgggg
ctttccttctgtggagcggatgtgggtggcttcttcaagaacccagagccagagctgctt
gtgcgctggtaccaaatgggtgcctaccagccgttctttcgggctcatgcccacttggac
actgggcggcgagagccatggctgttagcgtctcaataccaagatgcaatccgagatgcc
ttgttccagcgatattctttgctgcccttctggtataccctcttctatcaagctcacaag
gaagggtttcctgtcatgaggcccctctgggtacagtatcctgaggatatgtctaccttc
agtatagaggatcagttcatgcttggtgatgcactccttattcaccctgtatcggatgct
ggggcccacggagtgcaggtctatttgcctggccaagaagaagtgtggtatgacattcag
agctatcagaagcatcatgggccccagaccttgtatctgccagtaactttgagcagtatc
cccgtgttccagcgtggcggaaccattgtgcctcgatggatgcgtgtgaggcgctcttca
gactgtatgaaggacgatcctatcactctctttgttgctctcagtccccagggtactgcc
caaggagagctctttctagatgatggacacacctttaactatcagactcgccatgagttc
ctgttgcggcggttctctttctctggcagcacactggtctctagttcagcagaccccaaa
ggccaccttgagacacctatttggattgagcgagtagtcatcatgggggctggaaagcca
gcagctgtggtgctccagaccaaaggatcccctgaaagtcgcctgtccttccagcatgac
cctgagacctcagtgctgatattgcgtaaacctggtgtcagcgtggcatccgactggagt
attcatcttcgataa

KEGG   Mus musculus (mouse): 19089
Entry
19089             CDS       T01002                                 

Gene name
Prkcsh, 80K-H, PKCSH
Definition
(RefSeq) protein kinase C substrate 80K-H
  KO
K08288  protein kinase C substrate 80K-H
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    19089 (Prkcsh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    19089 (Prkcsh)
Lectins [BR:mmu04091]
 P-type lectins
  19089 (Prkcsh)
SSDB
Motif
Pfam: PRKCSH-like PRKCSH_1 PRKCSH EF-hand_5 EF-hand_1 EF-hand_6 Ldl_recept_a
Other DBs
NCBI-GeneID: 19089
NCBI-ProteinID: NP_001280580
MGI: 107877
Ensembl: ENSMUSG00000003402
Vega: OTTMUSG00000062326
UniProt: O08795 Q3U518
Structure
PDB: 

Position
9 A3; 9 8.04 cM
AA seq 521 aa
MLLLLLLLLPLCWAVEVKRPRGVSLSNHHFYEESKPFTCLDGTATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCREKG
RKEKESLQQLAEVTREGFRLKKILIEEWKTAREEKQSKLLELQAGKKSLEDQVETLRAAK
EEAERPEKEAKDQHRKLWEEQQAAAKARREQERAASAFQELDDNMDGMVSLAELQTHPEL
DTDGDGALSEEEAQALLSGDTQTDTTSFYDRVWAAIRDKYRSEVPPTDIPVPEETEPKEE
KPPVLPPTEEEEEEEEEPEEEEEEEEEEEEAPPPLQPPQPPSPTEDEKMPPYDEETQAII
DAAQEARSKFEEVERSLKEMEESIRSLEQEISFDFGPSGEFAYLYSQCYELTTNEYVYRL
CPFKLVSQKPKHGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGK
ETVVTSTTEPSRCEYLMELMTPAACPEPPPEAPSDGDHDEL
NT seq 1566 nt   +upstreamnt  +downstreamnt
atgctgctgctgctgctactactactacccctctgttgggctgtagaagttaagagaccc
cggggcgtttccctcagcaaccatcacttctatgaagaatctaaacctttcacctgtttg
gacggcacagccaccatcccattcgatcaggtgaacgacgactactgcgactgtaaggac
ggttcagatgagcctggcacagctgcttgtcccaatggcagctttcactgcaccaacact
gggtacaagcccttgtacatcctctccagccgggtcaatgatggggtatgtgactgctgt
gatggcacagacgagtacaacagcggcacggtctgcgagaacacctgcagagagaagggt
cgcaaggaaaaagagtccctgcagcagctggcggaagtcacccgtgaagggttccgcctg
aagaagattctcattgaggagtggaagacagcccgggaagaaaagcagagtaagcttctt
gagcttcaggctggaaagaagtctctggaagaccaggtagaaacactgcgggcagcgaaa
gaagaagcagagaggccagagaaggaggccaaggaccagcaccggaagctgtgggaagag
cagcaagctgctgccaaggcccggcgggaacaggagcgggcagccagtgccttccaggaa
cttgacgacaacatggatgggatggtctcgctggctgagttacagactcacccggagctg
gacacagatggagatggagcgctgtctgaggaggaggcccaggcccttctcagtggagac
acacagactgacaccacctccttctatgaccgtgtctgggctgccatcagggacaagtac
cgctctgaggtcccgcccactgacatacctgttccggaggagactgagcccaaagaggaa
aagccaccagtgttgccacccacagaggaggaggaagaggaggaggaggagccagaagaa
gaggaggaggaagaggaagaggaggaggaggctccgcccccactgcagcccccacagcct
cccagccccacagaggatgagaagatgccgccctatgatgaggagacccaggccatcatc
gatgctgcacaggaggcccggagtaagtttgaggaagtcgaacggtccttgaaagagatg
gaagagtccatcaggagtttggaacaagagatctcctttgatttcggtccctctggagag
tttgcatatctctacagccaatgctacgagctcaccaccaatgagtacgtctaccggctt
tgccccttcaaactggtctcccagaaacccaaacatgggggctccccgaccagcctgggc
acatggggctcctgggctggccctgatcatgacaagttcagtgcgatgaagtacgagcag
ggcacgggctgttggcagggccccaaccgatccaccacagtgcgcctgctgtgtggcaaa
gagactgtggtgaccagcaccacggagcccagtcgctgtgagtacctcatggagctgatg
acaccagcagcctgcccagagccgccaccagaagcacccagtgatggggaccatgacgag
ctgtag

DBGET integrated database retrieval system