KEGG   Mus musculus (mouse): 14377
Entry
14377             CDS       T01002                                 

Gene name
G6pc, AW107337, G6P, G6Pase, G6pt, Glc-6-, Glc-6-Pase
Definition
(RefSeq) glucose-6-phosphatase, catalytic
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    14377 (G6pc)
   00052 Galactose metabolism
    14377 (G6pc)
   00500 Starch and sucrose metabolism
    14377 (G6pc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    14377 (G6pc)
   04151 PI3K-Akt signaling pathway
    14377 (G6pc)
   04152 AMPK signaling pathway
    14377 (G6pc)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    14377 (G6pc)
   04922 Glucagon signaling pathway
    14377 (G6pc)
   04920 Adipocytokine signaling pathway
    14377 (G6pc)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    14377 (G6pc)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    14377 (G6pc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     14377 (G6pc)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 14377
NCBI-ProteinID: NP_032087
MGI: 95607
Ensembl: ENSMUSG00000078650
Vega: OTTMUSG00000002811
UniProt: P35576
Position
11; 11 D
AA seq 357 aa
MEEGMNILHDFGIQSTRYLQVNYQDSQDWFILVSVIADLRNAFYVLFPIWFHLKETVGIN
LLWVAVVGDWFNLVFKWILFGQRPYWWVLDTDYYSNSSVPIIKQFPVTCETGPGSPSGHA
MGAAGVYYVMVTSTLAIFRGKKKPTYGFRCLNVILWLGFWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFSHIRGIYNASLRKYCLITIFLFGFALGFYLLLKGLGVDLLWTLEK
AKRWCERPEWVHLDTTPFASLFKNLGTLLGLGLALNSSMYRKSCKGELSKLLPFRFACIV
ASLVLLHLFDSLKPPSQVELIFYILSFCKSATVPFASVSLIPYCLARILGQTHKKSL
NT seq 1074 nt   +upstreamnt  +downstreamnt
atggaggaaggaatgaacattctccatgactttgggatccagtcgactcgctatctccaa
gtgaattaccaagactcccaggactggttcatccttgtgtctgtgattgctgacctgagg
aacgccttctatgtcctctttcccatctggttccatcttaaagagactgtgggcatcaat
ctcctctgggtggcagtggtcggagactggttcaacctcgtcttcaagtggattctgttt
ggacaacgcccgtattggtgggtcctggacaccgactactacagcaacagctccgtgcct
ataataaagcagttccctgtcacctgtgagaccggaccaggaagtccctctggccatgcc
atgggcgcagcaggtgtatactatgttatggtcacttctactcttgctatctttcgagga
aagaaaaagccaacgtatggattccggtgtttgaacgtcatcttgtggttgggattctgg
gctgtgcagctgaacgtctgtctgtcccggatctaccttgctgctcactttccccaccag
gtcgtggctggagtcttgtcaggcattgctgtggctgaaactttcagccacatccggggc
atctacaatgccagcctccggaagtattgtctcatcaccatcttcttgtttggtttcgcg
cttggattctacctgctactaaaagggctaggggtggacctcctgtggactttggagaaa
gctaagagatggtgtgagcggccagaatgggtccaccttgacactacaccctttgccagc
ctcttcaaaaacctgggaaccctcttggggttggggctggccctcaactccagcatgtac
cggaagagctgcaagggagaactcagcaagttgctcccattccgcttcgcctgcattgtg
gcttccttggtcctcctgcatctctttgactctctgaagcccccatcccaggttgagttg
atcttctacatcttgtctttctgcaagagcgcaacagttccctttgcatctgtcagtctt
atcccatactgcctagcccggatcctgggacagacacacaagaagtctttgtaa

KEGG   Mus musculus (mouse): 14378
Entry
14378             CDS       T01002                                 

Gene name
G6pc2, G6pc, G6pc-rs, I, IGRP
Definition
(RefSeq) glucose-6-phosphatase, catalytic, 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    14378 (G6pc2)
   00052 Galactose metabolism
    14378 (G6pc2)
   00500 Starch and sucrose metabolism
    14378 (G6pc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    14378 (G6pc2)
   04151 PI3K-Akt signaling pathway
    14378 (G6pc2)
   04152 AMPK signaling pathway
    14378 (G6pc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    14378 (G6pc2)
   04922 Glucagon signaling pathway
    14378 (G6pc2)
   04920 Adipocytokine signaling pathway
    14378 (G6pc2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    14378 (G6pc2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    14378 (G6pc2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     14378 (G6pc2)
SSDB
Motif
Pfam: PAP2 CPP1-like
Other DBs
NCBI-GeneID: 14378
NCBI-ProteinID: NP_067306
MGI: 1277193
Ensembl: ENSMUSG00000005232
Vega: OTTMUSG00000012981
UniProt: Q9Z186
Position
2 C2; 2 39.66 cM
AA seq 355 aa
MDFLHRSGVLIIHHLQEDYRTYYGFLNFMSNVGDPRNIFSIYFPLWFQLNQNVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWIQETEIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSYTISRMEESSVTLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGVHMASLSVYLKTNVFLFLFALGFYLLLRLFGIDLLWSVPIAK
KWCANPDWIHIDSTPFAGLVRNLGVLFGLGFAINSEMFLRSCQGENGTKPSFRLLCALTS
LTTMQLYRFIKIPTHAEPLFYLLSFCKSASIPLMVVALIPYCVHMLMRPGDKKTK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggatttccttcataggagtggagtgcttattattcatcatctgcaggaggactaccgg
acttactatggttttctaaattttatgtccaatgttggagacccccgaaatatcttttct
atttacttcccactttggtttcagttgaatcagaatgttggaaccaagatgatctgggta
gcggtcataggggactggttcaatctcatatttaaatggatattgtttggccatcgtcct
tactggtggatacaagaaactgagatttatccaaatcattcaagcccatgtcttgagcag
tttcctactacgtgtgaaacaggcccaggaagtccatctggccacgcaatgggctcatcg
tgcgtctggtatgtcatggtaacagctgccctaagctacaccatcagccggatggaggag
tcctctgtcactctgcacagactgacctggtcctttctgtggagtgttttctggttgatt
caaatcagcgtctgcatctcaagagtattcatagccacacatttcccccatcaggtcatt
cttggagtgattggtgggatgctagtagccgaggcctttgaacacactccaggagtccac
atggccagcttgagtgtgtacctgaagaccaacgtcttcctcttcctgtttgccctcggc
ttttacctgcttctccgactgttcggtattgacctgctgtggtccgtgcccatcgccaaa
aagtggtgtgccaacccagactggatccacattgacagcacgccttttgctggactcgtg
agaaacctcggggtcctctttggcttgggtttcgccatcaactcagaaatgttccttcgg
agctgccagggagaaaatggcaccaagccgagcttccgcttgctctgtgctctgacctca
ctgaccacaatgcaactttatcgcttcatcaagatcccgactcacgcggaacctttattt
tacctgttgtctttctgtaaaagtgcgtccatccccctgatggtggtggctctaattccc
tactgtgtacatatgttaatgagacccggtgacaagaagactaaatag

KEGG   Mus musculus (mouse): 68401
Entry
68401             CDS       T01002                                 

Gene name
G6pc3, 0710001K01Rik, AU019276, AU045429, AV128920, AW545836, UGRP
Definition
(RefSeq) glucose 6 phosphatase, catalytic, 3
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    68401 (G6pc3)
   00052 Galactose metabolism
    68401 (G6pc3)
   00500 Starch and sucrose metabolism
    68401 (G6pc3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    68401 (G6pc3)
   04151 PI3K-Akt signaling pathway
    68401 (G6pc3)
   04152 AMPK signaling pathway
    68401 (G6pc3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    68401 (G6pc3)
   04922 Glucagon signaling pathway
    68401 (G6pc3)
   04920 Adipocytokine signaling pathway
    68401 (G6pc3)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    68401 (G6pc3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    68401 (G6pc3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     68401 (G6pc3)
SSDB
Motif
Pfam: PAP2
Other DBs
NCBI-GeneID: 68401
NCBI-ProteinID: NP_787949
MGI: 1915651
Ensembl: ENSMUSG00000034793
Vega: OTTMUSG00000002495
UniProt: Q6NSQ9
Position
11; 11 D
AA seq 346 aa
MESTLSAGIIMAEALQNRLPGLENMWLWVTFLGDPKNLFQFCFPAAYYASRRLGISVLWI
TFIAEWLNLVFKWFLFGDRPFWWVHESGYSTQTPIQIHQFPSSCETGPGSPSGHCMITGA
ALWPVMTAISSQVASRSRSPWVRVIPGLAYCTFLLAVGLSRVFLLAHFPHQVLGGLIVGA
ALGWLMSPRVPMERELSFYGLTALALMLGASLMYWTLFTLGLDLSWSINLASKWCERPEW
VHMDSRPFASLSRDSGSALGLGIALHTPCYAQIRRAHLGNGQKIACFVLAMGLLVFLEWL
GYPPQISLFYIFNFLKYTLWPCLVLALVPWVVHTLSDQEAPPIRSS
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggagtccacgctgagcgcgggcatcataatggctgaagcactacagaaccggcttccc
gggctagagaatatgtggctctgggtcacctttctgggcgatcctaagaatctttttcag
ttctgcttccccgcggcctactacgcctcccgccgcctgggcatctccgtgctctggatc
accttcattgctgagtggctcaaccttgtcttcaagtggtttctgtttggagacaggccc
ttttggtgggtgcatgaatccgggtactccacccagactccaatccagattcaccagttc
ccttcttcttgtgagactggtccaggcagcccctccggccactgcatgatcacaggcgca
gctctttggcctgtaatgacggccatttcttctcaggtggcttctcggtcccgcagcccc
tgggtgagggtgattcctggcctggcttattgtaccttcctattggcagtcggcctatct
cgggtcttcctcttagcacatttccctcaccaagtgttgggcggccttattgttggtgct
gcccttggctggctaatgagcccccgggtacccatggagcgggagcttagcttttatggg
ttgactgctctggccctcatgctgggtgccagcctcatgtattggactctctttacactg
ggcctagatctttcctggtccatcaacctggcttccaagtggtgtgaacggcccgagtgg
gtgcacatggacagtcggccttttgcctcactgagccgtgactcaggatctgccctgggt
ctgggcattgccctccacactccctgctatgcccagatacggcgggcgcacctagggaat
ggccagaaaatagcttgctttgtgctggccatggggctgctggtcttcctggaatggctg
ggctacccacctcagatcagcctcttctacatcttcaacttcctcaagtataccctctgg
ccgtgcctggtcttggcccttgtgccctgggtggtgcacacattgagtgaccaggaagca
ccgcccattcgctcctcttga

DBGET integrated database retrieval system