KEGG   Mus musculus (house mouse): 14378
Entry
14378             CDS       T01002                                 
Symbol
G6pc2, G6pc-rs, IGRP
Name
(RefSeq) glucose-6-phosphatase, catalytic, 2
  KO
K01084  glucose-6-phosphatase [EC:3.1.3.9]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu00052  Galactose metabolism
mmu00500  Starch and sucrose metabolism
mmu01100  Metabolic pathways
mmu04068  FoxO signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    14378 (G6pc2)
   00052 Galactose metabolism
    14378 (G6pc2)
   00500 Starch and sucrose metabolism
    14378 (G6pc2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    14378 (G6pc2)
   04151 PI3K-Akt signaling pathway
    14378 (G6pc2)
   04152 AMPK signaling pathway
    14378 (G6pc2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    14378 (G6pc2)
   04922 Glucagon signaling pathway
    14378 (G6pc2)
   04920 Adipocytokine signaling pathway
    14378 (G6pc2)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    14378 (G6pc2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    14378 (G6pc2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     14378 (G6pc2)
SSDB
Motif
Pfam: PAP2 FtsK_4TM CPP1-like
Other DBs
NCBI-GeneID: 14378
NCBI-ProteinID: NP_067306
MGI: 1277193
Ensembl: ENSMUSG00000005232
UniProt: Q9Z186
Position
2:69041417..69058337
AA seq 355 aa
MDFLHRSGVLIIHHLQEDYRTYYGFLNFMSNVGDPRNIFSIYFPLWFQLNQNVGTKMIWV
AVIGDWFNLIFKWILFGHRPYWWIQETEIYPNHSSPCLEQFPTTCETGPGSPSGHAMGSS
CVWYVMVTAALSYTISRMEESSVTLHRLTWSFLWSVFWLIQISVCISRVFIATHFPHQVI
LGVIGGMLVAEAFEHTPGVHMASLSVYLKTNVFLFLFALGFYLLLRLFGIDLLWSVPIAK
KWCANPDWIHIDSTPFAGLVRNLGVLFGLGFAINSEMFLRSCQGENGTKPSFRLLCALTS
LTTMQLYRFIKIPTHAEPLFYLLSFCKSASIPLMVVALIPYCVHMLMRPGDKKTK
NT seq 1068 nt   +upstreamnt  +downstreamnt
atggatttccttcataggagtggagtgcttattattcatcatctgcaggaggactaccgg
acttactatggttttctaaattttatgtccaatgttggagacccccgaaatatcttttct
atttacttcccactttggtttcagttgaatcagaatgttggaaccaagatgatctgggta
gcggtcataggggactggttcaatctcatatttaaatggatattgtttggccatcgtcct
tactggtggatacaagaaactgagatttatccaaatcattcaagcccatgtcttgagcag
tttcctactacgtgtgaaacaggcccaggaagtccatctggccacgcaatgggctcatcg
tgcgtctggtatgtcatggtaacagctgccctaagctacaccatcagccggatggaggag
tcctctgtcactctgcacagactgacctggtcctttctgtggagtgttttctggttgatt
caaatcagcgtctgcatctcaagagtattcatagccacacatttcccccatcaggtcatt
cttggagtgattggtgggatgctagtagccgaggcctttgaacacactccaggagtccac
atggccagcttgagtgtgtacctgaagaccaacgtcttcctcttcctgtttgccctcggc
ttttacctgcttctccgactgttcggtattgacctgctgtggtccgtgcccatcgccaaa
aagtggtgtgccaacccagactggatccacattgacagcacgccttttgctggactcgtg
agaaacctcggggtcctctttggcttgggtttcgccatcaactcagaaatgttccttcgg
agctgccagggagaaaatggcaccaagccgagcttccgcttgctctgtgctctgacctca
ctgaccacaatgcaactttatcgcttcatcaagatcccgactcacgcggaacctttattt
tacctgttgtctttctgtaaaagtgcgtccatccccctgatggtggtggctctaattccc
tactgtgtacatatgttaatgagacccggtgacaagaagactaaatag

DBGET integrated database retrieval system