KEGG   Mus musculus (mouse): 14381
Entry
14381             CDS       T01002                                 

Symbol
G6pdx, G28, G28A, G6p, G6pd, Gpd, Gpdx
Name
(RefSeq) glucose-6-phosphate dehydrogenase X-linked
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00030  Pentose phosphate pathway
mmu00480  Glutathione metabolism
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu05230  Central carbon metabolism in cancer
mmu05415  Diabetic cardiomyopathy
Module
mmu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mmu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    14381 (G6pdx)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    14381 (G6pdx)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    14381 (G6pdx)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    14381 (G6pdx)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14381 (G6pdx)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     14381 (G6pdx)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     14381 (G6pdx)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   14381 (G6pdx)
  Exosomal proteins of colorectal cancer cells
   14381 (G6pdx)
  Exosomal proteins of bladder cancer cells
   14381 (G6pdx)
SSDB
Motif
Pfam: G6PD_C G6PD_N
Other DBs
NCBI-GeneID: 14381
NCBI-ProteinID: NP_032088
MGI: 105979
Ensembl: ENSMUSG00000031400
Vega: OTTMUSG00000017699
UniProt: Q00612 Q790Y8
Position
X A7.3; X 38.0 cM
AA seq 515 aa
MAEQVALSRTQVCGILREELYQGDAFHQADTHIFIIMGASGDLAKKKIYPTIWWLFRDGL
LPEDTFIVGYARSRLTVDDIRKQSEPFFKATPEERPKLEEFFARNSYVAGQYDDAASYKH
LNSHMNALHQGMQANRLFYLALPPTVYEAVTKNIQETCMSQTGWNRIIVEKPFGRDLQSS
NQLSNHISSLFREDQIYRIDHYLGKEMVQNLMVLRFANRIFGPIWNRDNIACVILTFKEP
FGTEGRGGYFDEFGIIRDVMQNHLLQMLCLVAMEKPATTGSDDVRDEKVKVLKCISEVET
DNVVLGQYVGNPNGEGEAANGYLDDPTVPHGSTTATFAAAVLYVENERWDGVPFILRCGK
ALNERKAEVRLQFRDVAGDIFHQQCKRNELVIRVQPNEAVYTKMMTKKPGMFFNPEESEL
DLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHKIDREKPQPI
PYVYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggcagagcaggtggccctgagccggacccaggtgtgtgggatcctgagggaagagttg
taccagggtgatgccttccaccaagctgatacacacatatttatcatcatgggtgcatcg
ggtgacctggccaagaagaagatctatcctaccatctggtggctgttccgggatggcctt
ctacctgaagataccttcattgtgggctatgcccgctcacgactcacagtggacgacatc
cgaaagcagagtgagcccttctttaaagccactccagaagaaagacctaagctggaggag
ttctttgcccgtaattcctatgtagctggccagtatgatgatgcagcctcctataagcac
ctcaacagccacatgaatgccctgcaccaggggatgcaggccaaccgtctattctacctg
gccttgccccccacagtctatgaagcagtcaccaagaacattcaagagacctgcatgagt
cagacaggctggaaccgcatcatcgtggagaagcccttcgggagagacctacagagctcc
aatcaactgtcgaaccacatctcctctcttttccgtgaggaccagatctaccgcattgac
cactacctgggcaaagagatggtccagaatctcatggtgctgaggtttgccaacaggatc
tttggccccatctggaatcgagacaacattgcttgtgtgatcctcacatttaaagagccc
tttggtactgagggtcgtgggggctattttgatgaatttgggatcatcagggatgttatg
cagaaccacctcctgcagatgttgtgtctggtggccatggaaaagcctgccactacaggt
tcagatgatgtccgtgatgagaaggtcaaagtgttgaagtgtatctcagaggtggaaact
gacaacgtggtccttggccaatatgtggggaaccccaatggagaaggagaagctgccaat
ggatacttagatgaccccacagtaccccatgggtccaccactgccacttttgcagcagct
gtcctctatgtggagaatgaacggtgggacggggtacccttcatcctgcgctgtggcaaa
gccctgaatgaacgcaaagctgaagtgagactgcagttccgagacgtggcaggtgacatc
ttccaccaacagtgcaagcgtaatgagctggtcatccgtgtgcagcccaatgaggcagta
tacaccaagatgatgaccaagaagcctggcatgttctttaaccctgaggagtcggagctg
gatctaacttatggcaacagatacaagaatgtgaagctccctgatgcctatgaacgcctc
atcctggatgtcttctgtgggagccagatgcactttgtccggagtgatgaactcagggaa
gcctggcgtatcttcacaccactgctgcacaagattgatcgagaaaagccccagcccatc
ccctatgtatatggcagccgcggccccacagaggcagatgagctgatgaagagagtgggc
ttccagtacgagggtacctacaagtgggtgaaccctcacaagctctga

DBGET integrated database retrieval system