KEGG   Mus musculus (mouse): 14388Help
Entry
14388             CDS       T01002                                 

Gene name
Gab1, AA408973, AW107238
Definition
(RefSeq) growth factor receptor bound protein 2-associated protein 1
  KO
K09593  GRB2-associated-binding protein 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05100  Bacterial invasion of epithelial cells
mmu05205  Proteoglycans in cancer
mmu05211  Renal cell carcinoma
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14388 (Gab1)
   04012 ErbB signaling pathway
    14388 (Gab1)
   04072 Phospholipase D signaling pathway
    14388 (Gab1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    14388 (Gab1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    14388 (Gab1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    14388 (Gab1)
   05226 Gastric cancer
    14388 (Gab1)
   05211 Renal cell carcinoma
    14388 (Gab1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    14388 (Gab1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    14388 (Gab1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PH PH_11 PH_3 PH_8 PH_13
Motif
Other DBs
NCBI-GeneID: 14388
NCBI-ProteinID: NP_067331
MGI: 108088
Ensembl: ENSMUSG00000031714
Vega: OTTMUSG00000061338
UniProt: Q9QYY0 Q505A4
Position
8; 8 C2
AA seq 695 aa AA seqDB search
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEDMNKWVRCICDICGFNPT
EEDPVKPLTGSSQAPVDSPFAISTAPASSQMEASSVALPPPYQVISLPPHPDTLGLQDDP
QDYLLLINCQSKKPEPNRTLFDSAKPTFSETDCNDNVPSHQTPASSQSKHGMNGFFQQQM
MYDCPPSRLTSVSGESSLYNLPRSYSHDVLPKESPSSTEADGELYTFNTPSGTAGVETQM
RHVSISYDIPPTPGNTYQIPRTFPESTLGQSSKLDTIPDIPPPRPPKPHPTHDRSPVETC
GVPRTASDTDSSYCIPPPAGMTPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSS
LEGFHSQYKIKSVLTAGGVSGEELDENYVPMNPNSPPRQHSGSFTEPIQEPNYVPMTPGT
FDFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKVKPAPLDIKPL
SEWEELQAPVRSPITRSFARDSSRFPMSPRPDSVHSTTSSSDSHDSEENYVPMNPNLSGE
DPNLFASNSLDGGSSPMNKPKGDKQVEYLDLDLDSGKSTPPRKQKSSGSGSSMADERVDY
VVVDQQKTLALKSTREAWTDGRQSTESETPTKNVK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcggcgaagtggtttgctcgggatggctccgcaagtcgcccccggagaagaag
ttgaagcgttatgcgtggaagagaaggtggtttgtgttgcgcagtggccgtttgactgga
gacccggatgtcctggagtattacaaaaacgatcatgccaagaagcctattcggattatt
gatttaaatttatgtcagcaagttgatgctgggttgacattcaacaaaaaggagtttgaa
aacagctatatctttgatatcaacaccatcgaccggattttctacttggtggcagatagt
gaggaagacatgaacaagtgggtccgttgtatctgtgacatctgtggattcaatcccaca
gaagaagatcctgtgaagccgctgactggctcctcacaagcacccgtcgattcacctttc
gctataagtacagcaccagcctccagtcagatggaagcttcttcagtcgcgctacctcct
ccttaccaggtcatcagccttccgccacacccagacaccctcggcctccaggacgatcca
caagactacctcttgctgatcaactgtcaaagcaagaagcctgaacctaacagaaccctc
tttgactctgccaagcccaccttttctgagacagactgcaatgacaacgtcccttcccac
cagactcctgcttcctcccagagcaaacacggaatgaatggctttttccagcaacaaatg
atgtatgactgcccaccgtcccggctgacatctgtctcgggagagtccagcctctataac
ctgcccaggagctattcccatgacgtgttgccaaaggaatccccatcaagcacggaggcc
gacggggagctgtacacctttaacaccccatctgggactgcaggtgtagaaacgcagatg
agacatgtatccatcagttacgacattccgccaacacctggcaacacttaccagatccca
cggacatttccagaaagcacactgggacagtcatcaaagctggacaccattcctgatatc
cccccacctcggccaccaaagccacatccaactcatgaccggtctcctgtggaaacgtgt
ggagtcccacgcacggcctcggacactgacagcagttactgtatccctcctccagcaggc
atgacgccctcccggagtaataccatttccaccgtggatttgaacaagttgcggaaagat
gctagttctcaagattgctatgatattccacggacctttccgagcgatagatctagttcc
ctggaaggcttccatagccagtataaaatcaaaagcgtgttgacagcgggaggtgtctcg
ggtgaagagctggatgagaactacgttcccatgaaccccaactcgccacctcgacaacat
tccggcagctttaccgagccaatccaggagccaaactatgtgccaatgaccccagggacc
tttgacttttcttcctttggaatgcaagtccctcctcctgctcatatgggcttcaggtcc
agcccaaagacccctcccaggaggccagttcctgttgctgactgtgaaccacccccggtg
gataggaacctcaagccagacagaaaagtcaagccggcacctttagacataaaacctctg
tcagaatgggaagagctgcaagccccagtcagatctcccatcaccaggagcttcgctcgg
gactcctctaggtttcccatgtcccctcggcctgattctgtgcacagtacgacatcgagc
agcgactctcatgacagtgaagagaactatgtccccatgaatccaaatctgtctggcgaa
gacccgaatctctttgccagcaacagccttgatgggggaagcagcccgatgaataaaccc
aaaggagacaaacaagtcgaatacctggatttagacctagattctgggaagtccacgcca
ccacggaagcaaaagagcagtggttctggcagcagcatggcagacgagagggtggattac
gttgtggtggaccaacagaagactctggccctgaagagtaccagagaagcttggacggat
gggaggcagtccacagagtccgagacacccaccaagaatgtgaagtga

DBGET integrated database retrieval system