KEGG   Mus musculus (mouse): 14389
Entry
14389             CDS       T01002                                 

Gene name
Gab2, AI463667, D130058I17Rik, p9, p97
Definition
(RefSeq) growth factor receptor bound protein 2-associated protein 2
  KO
K08091  GRB2-associated-binding protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04014  Ras signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04380  Osteoclast differentiation
mmu04664  Fc epsilon RI signaling pathway
mmu04666  Fc gamma R-mediated phagocytosis
mmu05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    14389 (Gab2)
   04072 Phospholipase D signaling pathway
    14389 (Gab2)
   04071 Sphingolipid signaling pathway
    14389 (Gab2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    14389 (Gab2)
   04666 Fc gamma R-mediated phagocytosis
    14389 (Gab2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    14389 (Gab2)
 09160 Human Diseases
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    14389 (Gab2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:mmu04990]
    14389 (Gab2)
Domain-containing proteins not elsewhere classified [BR:mmu04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   14389 (Gab2)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_2 PH_3 PH_8 PH_13
Other DBs
NCBI-GeneID: 14389
NCBI-ProteinID: NP_001155949
MGI: 1333854
Ensembl: ENSMUSG00000004508
Vega: OTTMUSG00000058176
UniProt: Q3ZB59
Position
7; 7 E1
AA seq 665 aa
MSGGGGDDVVCTGWLRKSPPEKKLRRYAWKKRWFILRSGRMSGDPDVLEYYKNEHSKKPL
RIINLNLCEQVDAGLTFNKKELQDSFVFDIKTSERTFYLVAETEADMNKWVQSICQICGF
NQAEESTDSLRNLSSASHGPRSSPAEFSSSQHLLRERKSSAPSHSSQPTLFTFEPPVSSH
MQPTLSTSAPQEYLYLHQCISRRTENARSASFSQGTRQKSDTAVQKLAQSNGHCINGVGG
QVHGFYSLPKPSRHNTEFKDSTYDLPRSLASHGHTKSSLTGSETDNEDVYTFKMPSNTLC
RELGDLLVDNMDVPTTPLSAYQIPRTFTLDKNHNAMTVATPGDSAIAPPPRPPKPSQAET
PQWGSIQQRPPISENSRSVAATIPRRNTLPAMDNSRLHRASSCETYEYPARGSGESASWS
AEPPGKTAVGRSNSASSDDNYVPMNPGSSTLLAMERPGDNSQSVYIPMSPGPHHFDPLGY
PSTALPIHRGPSRGSEIQPPPVNRNLKPDRKAKPTPLDLRNNTVIDELPFKSPVTKSWSR
INHTFNSSSSQYCRPISTQSITSTDSGDSEENYVPMQNPVSASPVPSGTNSPAPKKSTGS
VDYLALDFQPGSPSPHRKPSTSSVTSDEKVDYVQVDKEKTQALQNTMQEWTDVRQSSEPS
KGAKL
NT seq 1998 nt   +upstreamnt  +downstreamnt
atgagcggcggcggcggcgacgacgtggtgtgtaccggctggctgaggaaatcgcctccc
gagaagaagttgaggcgctatgcctggaagaaacgctggtttatacttcggagtggccga
atgagtggagatccagatgttctggaatactacaagaatgagcactccaagaaacccctg
cggatcatcaacctgaacttgtgtgagcaggtggatgcaggcctgaccttcaacaagaaa
gagctgcaggatagttttgtgtttgatatcaagaccagcgagcgcacattttacctggtg
gctgagacagaggctgacatgaataagtgggtccagagcatctgccagatctgcggcttc
aatcaggctgaagagagcacagactccctgaggaacctttcttcagccagtcatggtccc
cgctcttctccagctgagttcagctccagtcagcacctgctccgagaacggaagtcctca
gccccttcacactctagccagcctactttattcacgtttgagccccctgtgtcaagccac
atgcagcctaccttgtccaccagtgcacctcaggagtatctctacttgcaccagtgcata
agcagaaggacagaaaatgcaaggagtgccagcttctctcagggcacccggcagaagagt
gatacagctgtgcaaaaacttgcccagagcaatggacactgtatcaacggcgtcggaggt
caagtccatggcttctatagccttcccaagccaagccgacacaatacagaattcaaagac
agtacttatgatctcccacggagcctggcttcccatggccacaccaagagcagcctcaca
gggtctgagactgataacgaggatgtgtacaccttcaagatgcccagcaacaccctgtgt
cgggaacttggagacctccttgtggacaatatggatgtcccaaccactcctctctcagcc
taccagatccctagaactttcacactggacaagaaccacaatgccatgacagtggccact
cctggagattcagccatagctcccccaccccggccacccaagccaagtcaggcagaaaca
cctcaatggggcagcattcagcaaagacctccaatcagcgaaaatagcagatctgtagct
gctactatccccaggcgcaataccctccctgcaatggacaacagccgactccatcgagct
tcttcctgtgagacctacgagtacccggcacgaggcagtggggaaagtgccagctggtct
gctgaacctccaggaaagactgccgtaggtcgatcaaatagtgccagctctgatgacaac
tacgtgcccatgaacccaggttcttctaccctgctggctatggaacgaccaggggacaac
tcccagagtgtctacatccccatgagcccaggaccccatcactttgacccacttggctac
ccgtccacagcccttcctattcacagaggccccagccgaggaagtgaaatccagccaccc
ccggtcaaccgaaacctcaagcctgacagaaaagcaaagccaacaccccttgacctgaga
aacaacactgtcatcgatgagctgcccttcaagtcacctgtcaccaagtcttggtccagg
atcaaccacacctttaactccagttcctcccagtactgccgtcctatctccacacagagc
atcaccagcacagactcgggagacagtgaggagaactatgtccctatgcaaaacccagta
tctgcatcccctgttcccagtggcactaacagcccagctccaaagaagagtactggcagt
gtggattatctcgccctggacttccagccgggctccccaagccctcaccgcaagccatcc
acatcatctgtcacatcagatgagaaggtagactatgtccaagtggataaagagaagacc
caggccctgcagaacaccatgcaggagtggacagatgtgcggcagtcctccgaaccttcc
aagggtgccaagctgtaa

DBGET integrated database retrieval system