KEGG   Mus musculus (mouse): 14390Help
Entry
14390             CDS       T01002                                 

Gene name
Gabpa, GABPalpha
Definition
(RefSeq) GA repeat binding protein, alpha
  KO
K09441  GA-binding protein transcription factor, alpha
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14390 (Gabpa)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    14390 (Gabpa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets GABP-alpha SAM_PNT AAA_25
Motif
Other DBs
NCBI-GeneID: 14390
NCBI-ProteinID: NP_032091
MGI: 95610
Ensembl: ENSMUSG00000008976
Vega: OTTMUSG00000025176
UniProt: Q00422
Structure
PDB: 

Position
16 C3.3; 16 46.92 cM
AA seq 454 aa AA seqDB search
MTKREAEELIEIEIDGTEKAECTEESIVEQTYTPAECVSQAIDINEPIGNLKKLLEPRLQ
CSLDAHEICLQDIQLDPDRSLFDQGVKTDGTVQLSVQVISYQGMEPKLNILEIVKTAETV
EVVIDPDAHHAEAEAHLVEEAQVITLDGTKHITTISDETSEQVTRWAAALEGYRKEQERL
GIPYDPIHWSTDQVLHWVVWVMKEFSMTDIDLTTLNISGRELCSLNQEDFFQRVPRGEIL
WSHLELLRKYVLASQEQQMNEIVTIDQPVQIIPASVPPATPTTIKVINSSAKAAKVQRSP
RISGEDRSSPGNRTGNNGQIQLWQFLLELLTDKDARDCISWVGDEGEFKLNQPELVAQKW
GQRKNKPTMNYEKLSRALRYYYDGDMICKVQGKRFVYKFVCDLKTLIGYSAAELNRLVIE
CEQKKLARMQLHGIAQPVTAVALAATSLQADKEI
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgactaagagagaagcagaagagctgatagaaattgagatcgacgggactgagaaagca
gagtgcacagaagaaagcattgtggaacaaacctataccccagctgaatgtgtaagccag
gccatagacatcaatgaaccaataggcaatttaaagaaactactagaaccaagactgcag
tgttctttggatgctcatgaaatttgcctgcaagatattcagctggatccagaccgaagc
ttgtttgatcaaggagtgaaaacagatgggactgtacagcttagtgtacaggtaatttct
taccaaggaatggagccaaagttgaacattcttgaaattgttaagactgcggaaacggtc
gaggtggtcatcgatccagatgcccaccacgcggaagcagaagcgcatctcgttgaagaa
gctcaagtgataactcttgacggcaccaagcacattacgaccatttcagacgagacctcg
gagcaggtgacgagatgggctgctgcactggaaggctacagaaaagagcaggagcgcctt
ggcatcccctatgatcctatacactggtccacggaccaagtcctgcattgggtggtttgg
gtaatgaaggagttcagcatgactgatatagacctcaccacactcaacatttcgggaaga
gaattatgtagtctcaaccaagaagatttttttcagcgggtccctcggggagaaattctt
tggagtcatctggagcttcttcgaaaatatgttttggccagccaagagcaacagatgaat
gagatagttaccattgaccagcctgtgcagattattccagcctcagtgcctcccgctaca
ccgactacgattaaagttataaacagcagtgcaaaagcagctaaagtgcaacggtcccca
aggatttcaggagaagacagaagttcaccggggaacagaacaggaaacaatggtcagatc
caactatggcagtttttgctagaacttcttactgacaaggatgctcgagactgtatttct
tgggttggtgatgaaggtgaatttaagctaaatcagcctgagttggttgcgcaaaaatgg
ggacaacgtaagaacaagcctaccatgaactatgagaaacttagccgtgcattacggtat
tattatgatggggacatgatttgtaaagttcaaggcaagagatttgtgtacaaatttgtt
tgtgacttgaagactcttattggatacagtgcagcagaactgaaccgtctggtcatagag
tgtgaacagaagaaactggcacggatgcagctgcatgggattgcccagccagtcacggca
gtagcactggcagccacctctctacaggcagacaaagagatttga

DBGET integrated database retrieval system