KEGG   Mus musculus (mouse): 14394Help
Entry
14394             CDS       T01002                                 

Gene name
Gabra1, GABAA-alpha1, GABAAR-alpha1, Gabra-1
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit alpha 1
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu04742  Taste transduction
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14394 (Gabra1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14394 (Gabra1)
   04723 Retrograde endocannabinoid signaling
    14394 (Gabra1)
  09157 Sensory system
   04742 Taste transduction
    14394 (Gabra1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14394 (Gabra1)
   05033 Nicotine addiction
    14394 (Gabra1)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   14394 (Gabra1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 14394
NCBI-ProteinID: NP_034380
MGI: 95613
Ensembl: ENSMUSG00000010803
Vega: OTTMUSG00000005445
UniProt: P62812 Q544F7 Q3URD4
Position
11 A5; 11 24.97 cM
AA seq 455 aa AA seqDB search
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtcggggtctctctgactatctttgggcctggaccctcattctgagcaca
ctgtcgggaagaagctatggacagccctcccaagatgaacttaaagacaacaccactgtc
ttcacaagaattttggaccgactgctggacggttatgacaatcgtctgagaccaggtttg
ggagagcgtgtaactgaagtgaagaccgacattttcgtcaccagtttcggaccagtttca
gaccacgatatggagtatacaatagatgtgtttttccgtcaaagttggaaggatgaaaga
ttaaaattcaaaggacccatgacagtgctccggctaaacaaccttatggccagtaaaatc
tggactccagatacatttttccacaatggaaagaagtctgtggcccacaacatgaccatg
cctaataagctcctgcgtatcacagaggatggcactctgctgtacaccatgaggttgacc
gtgagagctgaatgcccaatgcacttggaagacttccctatggatgcccatgcctgccca
ctaaaattcggaagctatgcttatacaagagcagaagttgtctatgagtggaccagagag
ccagcccgttcagtggttgtagcagaagatgggtcacgtttaaaccagtatgaccttctt
ggacaaacagttgactctggaattgttcagtccagtactggagaatatgtggttatgacg
actcacttccacttgaagagaaaaattggctactttgttattcaaacatatctgccgtgc
ataatgacagttattctctcccaagtctccttctggctcaacagagagtcagtaccagca
agaactgtctttggagtgacgactgttctgactatgacaaccttgagtatcagtgccaga
aattccctcccgaaggtggcttatgcaacagctatggactggtttattgcagtatgctat
gcctttgttttctcagctctgattgagtttgccacagtaaactatttcaccaagagaggg
tatgcgtgggatggcaaaagcgtggttccagaaaagccaaagaaagtaaaggatcctctc
attaagaaaaacaacacatatgctcctacagcaaccagctatacccctaacttagccagg
ggtgaccccggcttggcaactattgctaaaagtgcgaccatagaaccgaaagaagtcaag
cctgagacaaaaccaccagaacccaagaaaacctttaacagcgtcagcaaaatcgaccga
ctgtcaagaatagcctttccgctgctatttggaatctttaacttagtctattgggccacg
tatttaaacagagagcctcagctaaaagcccccacaccccatcaatag

DBGET integrated database retrieval system