KEGG   Mus musculus (mouse): 14396Help
Entry
14396             CDS       T01002                                 

Gene name
Gabra3, Gabra-3
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit alpha 3
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu04742  Taste transduction
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14396 (Gabra3)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    14396 (Gabra3)
   04723 Retrograde endocannabinoid signaling
    14396 (Gabra3)
  Sensory system
   04742 Taste transduction
    14396 (Gabra3)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    14396 (Gabra3)
   05033 Nicotine addiction
    14396 (Gabra3)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   14396 (Gabra3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 14396
NCBI-ProteinID: NP_032093
MGI: 95615
Ensembl: ENSMUSG00000031343
Vega: OTTMUSG00000017849
UniProt: P26049 Q8CAB3
Position
X A7.3; X 37.24 cM
AA seq 492 aa AA seqDB search
MIITQMWHFYVTRVVLLLLISILPGTTSQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDS
TDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQ
TWHDERLKFDGPMKILPLNNLLASKIWTPDTFFHNGKKSVAHNMTTPNKLLRLVDNGTLL
YTMRLTIHAECPMHLEDFPMDVHACPLKFGSYAYTKAEVIYSWTLGKNKSVEVAQDGSRL
NQYDLLGHVVGTEIIRSSTGEYVVMTTHFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLN
RESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFVFSALIEFATVN
YFTKRSWAWEGKKVPEALEMKKKTPAAPTKKNTTFNIVGTTYPINLAKDTEFSTISKSAA
APSASSTPTAIASPKATYVQDSPAETKTYNSVSKVDKISRIIFPVLFAIFNLVYWATYVN
RESAIKGMIRKQ
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgataatcacacaaatgtggcacttttatgtgaccagagttgtacttcttctcctgatt
agtattctccctggaaccactagccaaggggaatcaagacgacaagaacctggggacttt
gtgaaacaagatattggaggactctctcccaagcatgccccagatattcctgacgatagt
acagataatatcactatcttcactagaatcttggatcggcttttggatggctatgataac
cggcttcgacctggacttggagatgcagtgactgaagtgaagacagacatctatgtgacc
agttttggccctgtgtcagacactgatatggaatatactattgatgtattttttagacag
acatggcatgatgaaagactgaaatttgatggaccaatgaagatccttccactgaacaat
cttctggctagtaagatatggactcctgataccttcttccacaatggtaaaaaatcagtg
gctcacaatatgaccacacccaacaagctgctcagactggtagataatgggaccctcctc
tatacaatgaggttaacaatacacgctgaatgccccatgcatttggaagatttccccatg
gatgtgcatgcctgcccactgaagtttggaagctatgcctataccaaagctgaagtaatt
tattcttggactcttgggaagaacaaatctgtggaagtagcacaggatggctcacgcctg
aatcagtatgacttgcttggccatgttgttgggacagagataatccggtctagtacagga
gaatatgtcgtcatgacaacccactttcatctgaagagaaaaattggctactttgtcatc
cagacctacttgccatgtatcatgactgtcattctgtcacaagtgtctttctggcttaat
agagaatctgtccctgcccgcacagtctttggtgtcaccactgttctcaccatgaccacc
ttgagtatcagtgccagaaactctttacctaaagtggcatacgcgacggccatggactgg
ttcatagccgtctgttatgcctttgtattttctgcactgattgaatttgctactgtcaac
tacttcaccaagcggagttgggcttgggaaggcaagaaggtaccagaggccctggagatg
aagaagaaaacaccagcagctccaacaaagaaaaacaccaccttcaacatagtgggtacc
acctatcctatcaatctggccaaggatactgagttctccaccatctccaagtctgctgct
gctcccagtgcttcttcaactccaacagcgattgcttcacccaaggctacttatgtgcaa
gacagtcctgctgagaccaagacctacaacagtgtcagcaaggttgacaaaatttcccgc
atcatcttccctgtgctctttgccatattcaatcttgtctattgggctacatatgtgaac
cgggaatcagctatcaagggcatgatccgcaaacagtag

DBGET integrated database retrieval system