KEGG   Mus musculus (mouse): 14397
Entry
14397             CDS       T01002                                 

Gene name
Gabra4, Gabra-4
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit alpha 4
  KO
K05175  gamma-aminobutyric acid receptor subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu04742  Taste transduction
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14397 (Gabra4)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14397 (Gabra4)
   04723 Retrograde endocannabinoid signaling
    14397 (Gabra4)
  09157 Sensory system
   04742 Taste transduction
    14397 (Gabra4)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14397 (Gabra4)
   05033 Nicotine addiction
    14397 (Gabra4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14397 (Gabra4)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   14397 (Gabra4)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb CytochromB561_N
Other DBs
NCBI-GeneID: 14397
NCBI-ProteinID: NP_034381
MGI: 95616
Ensembl: ENSMUSG00000029211
Vega: OTTMUSG00000054261
UniProt: Q9D6F4 Q543Z0
Position
5; 5 C3.1-C3.2
AA seq 552 aa
MVSVQKVPAIALCSGVSLALLHFLCLAACLNESPGQNSKDEKLCPENFTRILDSLLDGYD
NRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTMDVFFRQTWIDKRLKYDGPIEILRLN
NMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIMRNGTILYTMRLTISAECPMRLVDFP
MDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVPKESSSLVQYDLIGQTVSSETIKSIT
GEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQVSFWINKESVPARTVFGITTVLTMT
TLSISARHSLPKVSYATAMDWFIAVCFAFVFSALIEFAAVNYFTNIQMQKAKKKISKPPP
EVPAAPVLKEKHTETSLQNTHANLNMRKRTNALVHSESDVKSRTEVGNHSSKTSAVQESS
EATPKAHLASSPNPFSRANAAETMSAAARGLSSAASPSPHGTLRPASLGSASTRPAFGSR
LGRIKTTVNTTGAAGNVSATPPPPAPPPSGSGTSKIDKYARILFPVTFGAFNMVYWVVYL
SKDTMEKSESLM
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggtttctgtccagaaggtacccgcgattgcgctgtgctccggggtcagcctcgccctc
ctgcacttcctgtgcctggcggcttgtttaaacgaatccccaggacagaactcaaaggac
gagaaattgtgcccggaaaattttacccgtattctggacagtttgctggatggttatgac
aacaggctgcgtcctggatttgggggtcctgttacagaagtgaaaactgatatatatgtc
accagctttgggcccgtttctgatgttgaaatggaatacactatggatgtgttcttcaga
cagacatggattgacaaaagactaaaatatgacggcccaattgaaatcttgaggctgaat
aatatgatggtcaccaaagtttggacccctgatactttcttcaggaatggaaagaaatct
gtctcacataacatgacagctccaaataagctttttagaattatgagaaatggcactatt
ttatacacaatgagactcaccataagtgcggagtgccccatgagactggtggattttcct
atggatggtcatgcctgccctttgaaatttgggagttatgcatatcccaaaagtgagatg
atctacacctggaccaaaggccctgagaagtcagtggaggtgccaaaggagtcttctagc
ttagttcaatatgacctcattgggcagactgtatcaagcgagactatcaaatctattaca
ggtgaatacattgttatgacggtttacttccacctcagacggaagatgggctactttatg
attcagacgtatatcccatgcatcatgacagtgattctttctcaagtttccttctggata
aacaaggagtctgttccagctagaactgtatttggaataaccacagtcctcacgatgacc
accctaagcatcagtgctcggcattctttgcccaaagtgtcctatgcgactgccatggat
tggttcatagctgtctgttttgcttttgtattttcggctcttattgagtttgctgctgtc
aactatttcaccaacattcaaatgcagaaagccaaaaagaagatatcaaagcctccccca
gaagttccagctgctcctgtgctgaaggagaaacacacagaaacatcccttcagaataca
catgccaatttgaacatgaggaaaagaacaaatgccttggtccattcagaatcggatgtc
aaaagcagaactgaggtgggaaatcactccagcaagaccagcgctgtccaggagtcttct
gaagccacgcctaaggctcacttagcttccagtccaaatccattcagcagggcaaatgca
gctgagactatgtctgctgcagccagaggtctttcatctgcagcatccccctctcctcat
ggcacattgcggccagcttctttggggtcagcttccactcgccctgcatttggatctaga
cttgggcgaattaagacaacagttaatacaacaggggctgctgggaatgtgtcagccaca
cctcctccccctgctccaccgccttctggatctggcacaagtaaaatagacaaatatgct
cgtattctctttccagtcacatttggagcatttaacatggtctactgggttgtttattta
tctaaggacaccatggagaaatcagaaagtctaatgtaa

DBGET integrated database retrieval system