KEGG   Mus musculus (mouse): 14400
Entry
14400             CDS       T01002                                 

Gene name
Gabrb1, AW061132, B230208N19Rik, Gabrb-1
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit beta 1
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14400 (Gabrb1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14400 (Gabrb1)
   04726 Serotonergic synapse
    14400 (Gabrb1)
   04723 Retrograde endocannabinoid signaling
    14400 (Gabrb1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14400 (Gabrb1)
   05033 Nicotine addiction
    14400 (Gabrb1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14400 (Gabrb1)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   14400 (Gabrb1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 14400
NCBI-ProteinID: NP_032095
MGI: 95619
Ensembl: ENSMUSG00000029212
Vega: OTTMUSG00000024372
UniProt: P50571 Q53WT3
Position
5 C3.2; 5 38.18 cM
AA seq 474 aa
MWTVQNRESLGLLSFPVMVAMVCCAHSSNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNRLEMNKVQ
VDAHGNILLSTLEIRNETSGSEVLTGVSDPKATMYSYDSASIQYRKPLSSREGFGRGLDR
HGVPGKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH
NT seq 1425 nt   +upstreamnt  +downstreamnt
atgtggacagtacaaaatcgagagagtttggggcttctctcttttcccgtgatggttgct
atggtttgttgtgcacacagctccaatgaacccagcaacatgtcatacgtgaaagagaca
gtggaccgactgctcaaaggatatgacattcgcttgcggccggactttggagggcccccg
gtggacgtcgggatgcggatcgatgtcgccagcatagacatggtctcggaagtgaatatg
gattatacactcaccatgtatttccagcagtcttggaaggacaagaggctttcatattct
ggaatcccattaaatctgacccttgacaacagagtagctgaccaactctgggtaccagac
acctactttctcaatgacaagaaatcatttgtgcatggggtcacagtgaaaaaccgaatg
atcaggctgcatcctgatggaactgttctctatggactacggatcacaaccactgcagca
tgcatgatggatcttcgaagataccctctggatgagcaaaactgcaccctggagattgaa
agttatggctataccacggatgacatcgaattttactggaatggaggagagggagcagta
actggggtcaataaaattgagcttccccaattttcaattgttgactacaagatggtgtcc
aagaaggtggagttcacaacaggggcatatccacgactatcactaagttttcgtctaaag
agaaacattggttacttcattttgcagacctacatgccttccacactgattacaatcctg
tcctgggtgtcgttttggatcaactatgatgcatctgcagccagagtcgcactaggaatc
actacggtgctgaccatgaccaccatcagcactcacctcagggagactttgccgaagatc
ccttacgtcaaagcgattgacatctatctcatgggctgttttgtgtttgtgttcctggct
ctactggaatatgcttttgtcaattacattttcttcggaaaaggccctcagaaaaaggga
gcgagcaaacaagaccagagtgccaatgaaaagaacagactggagatgaacaaagtccaa
gttgatgcccacggcaatattctcctcagcaccctggaaatcaggaacgagaccagtggc
tccgaggtgctcacaggtgtaagtgaccccaaggccaccatgtactcgtacgacagcgcc
agcatccagtaccgcaagccactgagcagccgcgagggcttcgggcgtgggctggacagg
cacggggtaccgggcaaggggcgcatccgcaggcgcgcctcgcagctcaaagtgaagatc
cccgacttgactgacgtgaactccatagacaagtggtcccgaatgttcttccccatcacc
ttttctctttttaatgtcgtttattggctttactatgtacactaa

DBGET integrated database retrieval system