KEGG   Mus musculus (mouse): 14401Help
Entry
14401             CDS       T01002                                 

Gene name
Gabrb2, AI834970, C030002O17Rik, C030021G16Rik, Gabrab2, Gabrb-2
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit beta 2
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14401 (Gabrb2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14401 (Gabrb2)
   04726 Serotonergic synapse
    14401 (Gabrb2)
   04723 Retrograde endocannabinoid signaling
    14401 (Gabrb2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14401 (Gabrb2)
   05033 Nicotine addiction
    14401 (Gabrb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14401 (Gabrb2)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   14401 (Gabrb2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 14401
NCBI-ProteinID: NP_001334243
MGI: 95620
Ensembl: ENSMUSG00000007653
Vega: OTTMUSG00000006331
UniProt: P63137
Position
11 A5; 11 25.08 cM
AA seq 512 aa AA seqDB search
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAANANNEKMRLDVNKM
FYKDIKQNGTQYRSLWDPTGDLSPTRRTTNYDFSLYTMDPHENILLSTLEIKNEMATSEA
VMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALERHVAQKKSRLRRRASQLKITIPD
LTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgtggagagtccggaaaaggggctactttgggatttggtcatttcccttaataatcgcc
gctgtctgtgctcagagtgtcaatgaccctagtaatatgtcgctggttaaagagacggtg
gacagactgttgaaaggctatgacattcgtctgagaccagattttggaggtccccctgtg
gccgtaggaatgaacattgatattgccagcattgatatggtttctgaggtcaatatggac
tataccttgaccatgtattttcagcaagcctggagagacaagaggctgtcttacaatgta
attcctttaaacttgactttggacaaccgagtggcagaccaactctgggtgcctgacacc
tacttcctgaatgataagaagtcatttgtacatggagtgactgtcaaaaaccgtatgatt
cgattgcatcccgatggcactgtcctgtatggcctcagaatcacaactacggctgcctgc
atgatggacctaaggcggtatccactggatgaacaaaactgtacattggagattgaaagc
tatggctacacaactgatgacattgagttttactggcgcggcgatgacaatgcagtcaca
ggagtgacaaagattgagcttcctcagttctccatcgtagattataaactcatcaccaag
aaagttgttttctccacaggttcttatcccagattgtccctaagctttaagctgaaaagg
aacattggctacttcatcctgcagacatacatgccatcaattctgattaccattctctcc
tgggtctccttttggattaactatgatgcctctgctgcacgggttgcattaggaattaca
actgtcctaacaatgaccacaatcaacacccacctccgggaaactctccctaaaatcccc
tatgtcaaagccattgacatgtacctaatggggtgctttgtcttcgtctttatggccctt
ctggaatacgctttggtcaactacatcttctttgggagaggaccccagcgccaaaagaaa
gcagctgagaaagctgctaatgccaacaatgagaagatgcgcctggatgtcaacaagatg
ttttataaagatattaaacaaaatgggacccagtatcgatccttgtgggaccctactgga
gacctctccccaactagacggactaccaattatgatttctctctgtatacgatggacccc
catgagaacatcttactcagcacgcttgagataaaaaacgagatggccacatccgaagca
gtaatgggacttggagaccccaggagcacaatgcttgcctatgatgcctccagcatccag
tatcgaaaagctgggctgcctaggcatagttttggccgcaacgctctggagcgacatgtg
gcacaaaagaaaagtcgcctgaggagacgtgcctctcaactgaaaatcaccatccccgac
ttgactgatgtgaatgccattgatcggtggtcccgcattttcttccctgtggtgttttcc
ttcttcaacatcgtctattggctttattatgtgaactaa

DBGET integrated database retrieval system