KEGG   Mus musculus (mouse): 14402
Entry
14402             CDS       T01002                                 

Gene name
Gabrb3, A230092K12Rik, AW049585, Cp1, Gabrb-3, beta3
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit beta 3
  KO
K05181  gamma-aminobutyric acid receptor subunit beta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04726  Serotonergic synapse
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14402 (Gabrb3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14402 (Gabrb3)
   04726 Serotonergic synapse
    14402 (Gabrb3)
   04723 Retrograde endocannabinoid signaling
    14402 (Gabrb3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14402 (Gabrb3)
   05033 Nicotine addiction
    14402 (Gabrb3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14402 (Gabrb3)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   14402 (Gabrb3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb OAD_gamma
Other DBs
NCBI-GeneID: 14402
NCBI-ProteinID: NP_032097
MGI: 95621
Ensembl: ENSMUSG00000033676
Vega: OTTMUSG00000031173
UniProt: P63080
Position
7 B5; 7 33.53 cM
AA seq 473 aa
MWGFAGGRLFGIFSAPVLVAVVCCAQSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPP
VCVGMNIDIASIDMVSEVNMDYTLTMYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWRGGDKAVTGVERIELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLK
RNIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKI
PYVKAIDMYLMGCFVFVFLALLEYAFVNYIFFGRGPQRQKKLAEKTAKAKNDRSKSEINR
VDAHGNILLAPMDVHNEMNEVAGSVGDTRNSAISFDNSGIQYRKQSMPKEGHGRYMGDRS
IPHKKTHLRRRSSQLKIKIPDLTDVNAIDRWSRIVFPFTFSLFNLVYWLYYVN
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtggggctttgcgggaggaaggcttttcggcatcttctcggccccggtgctggtggcg
gtggtttgctgcgctcagagcgtaaacgaccccgggaacatgtcctttgtgaaggagacg
gtcgacaagctgttgaaaggctacgacattcgcctgagacccgacttcgggggtccccca
gtctgcgtggggatgaacatcgacatcgccagcatcgacatggtttctgaagtcaacatg
gattataccttaactatgtatttccaacaatactggagagataaaaggctcgcctattct
gggatccctctcaacctcacgcttgacaatcgagtggctgaccagctctgggtgcccgac
acatatttcttaaatgacaaaaagtcatttgtccacggagtgacagtgaaaaaccgcatg
atccgcctccaccctgatgggacagtgctgtatgggctcaggatcactacgacagcagcg
tgcatgatggacctcagaagatacccactggatgagcaaaactgcactttggaaattgaa
agctatggctacactacggatgacattgaattttactggcgtggcggggacaaggctgtc
actggcgtggaaaggatcgagctcccacagttctccattgtagagcaccgtctggtctcc
aggaatgttgtcttcgccacaggtgcctatcctcgactttcattgagttttcggttgaag
agaaatatcgggtacttcattcttcagacgtatatgccctcaatcctgatcacaatcctc
tcgtgggtgtccttctggatcaattacgatgcatctgctgctcgagttgcccttgggatt
accaccgtgctcaccatgacaaccatcaacactcaccttcgggagactctacccaaaatt
ccctatgtcaaagccatcgacatgtacctgatgggctgctttgtctttgtattcctggca
cttctggagtacgcctttgtcaactacattttctttggaagaggtccccaaaggcagaag
aagcttgcggagaagacagccaaggccaagaatgatcgttctaagagtgaaataaaccgg
gtggatgctcacgggaatatcctattagcaccgatggatgttcacaatgaaatgaatgag
gttgcaggcagcgttggtgacaccaggaattcagcaatatcctttgacaactcaggaatc
cagtataggaaacagagcatgcccaaggaagggcatgggcggtacatgggagacagaagc
atcccgcacaagaagacccacctacggaggaggtcttcacagctcaaaatcaaaatccct
gatctaaccgatgtgaatgccatagacagatggtcccgcatcgtgtttccattcaccttt
tctctcttcaatttagtttactggctgtactatgttaactga

DBGET integrated database retrieval system