KEGG   Mus musculus (mouse): 14403Help
Entry
14403             CDS       T01002                                 

Gene name
Gabrd, AI853201
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit delta
  KO
K05184  gamma-aminobutyric acid receptor subunit delta
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14403 (Gabrd)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14403 (Gabrd)
   04723 Retrograde endocannabinoid signaling
    14403 (Gabrd)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14403 (Gabrd)
   05033 Nicotine addiction
    14403 (Gabrd)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14403 (Gabrd)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   14403 (Gabrd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 14403
NCBI-ProteinID: NP_032098
MGI: 95622
Ensembl: ENSMUSG00000029054
Vega: OTTMUSG00000010612
UniProt: P22933 Q14AH9
Position
4; 4 E2
AA seq 449 aa AA seqDB search
MDVLGWLLLPLLLLCTQPHHGARAMNDIGDYVGSNLEISWLPNLDGLMEGYARNFRPGIG
GAPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLW
LPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPLDEQECML
DLESYGYSSEDIVYYWSENQEQIHGLDRLQLAQFTITSYRFTTELMNFKSAGQFPRLSLH
FQLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSS
LPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADYRKKRKAKVKVTKPRAEMDVRNAI
VLFSLSAAGVSQELAISRRQGRVPGNLMGSYRSVEVEAKKEGGSRPGGPGGIRSRLKPID
ADTIDIYARAVFPAAFAAVNIIYWAAYTM
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atggacgttctgggctggctgctgctgccgctcctgctgctctgcacgcagccgcaccat
ggcgccagggcaatgaatgacattggggactacgtgggctccaacctggaaatatcctgg
ctccccaacctggatggcttaatggagggctatgcccgaaacttccgaccaggcattgga
ggtgctcctgtgaatgtggcgcttgccctagaggtggccagcattgaccatatctcagag
gcaaacatggaatacaccatgactgtgttcctgcatcagagctggcgggacagcaggctg
tcctacaaccataccaacgagaccttaggcctggacagccgctttgtggacaagctatgg
ctccctgacaccttcatcgtgaatgccaaatctgcctggttccatgatgtgactgtggaa
aacaagcttatccgcctacagcctgatggggtgattttatacagcatccgcatcacctcc
acagtggcctgtgacatggacctcgccaagtacccactggatgagcaggagtgcatgctg
gacctagagagctatggctactcttctgaggacattgtctattattggtcagaaaaccag
gagcagatccatgggctggacaggctgcagctggcccagttcactatcaccagttaccgc
ttcaccacggagctgatgaacttcaaatcggctggccagttcccacggctcagcttacac
ttccagcttcggaggaaccggggcgtctacatcatccagtcttacatgccctctgtcctc
ctggttgccatgtcctgggtctccttctggattagccaggcagccgtgcctgccagagta
tctctaggcatcaccactgtgctgacaatgaccacgctcatggtcagtgcccgctcctcc
ctgccacgggcttcagctatcaaagctctggatgtgtatttttggatctgctacgtcttt
gtgtttgctgccctggtggagtatgcatttgcccacttcaatgccgactacaggaagaaa
cggaaagccaaggtcaaggtcaccaagccaagggcagagatggatgtgaggaacgccatc
gtccttttctccctctcagctgctggggtcagtcaggagttggctatctcccgtcgtcaa
ggccgggtccctgggaacctcatgggttcctataggtctgtggaagtggaggcaaagaag
gagggggggtcccgcccagggggcccaggaggaatccgttccagactcaaacccatcgat
gcagacaccatcgacatctatgcccgcgccgtcttcccggcagcttttgcagcggtcaac
atcatctactgggcggcgtacaccatgtga

DBGET integrated database retrieval system