KEGG   Mus musculus (mouse): 14405Help
Entry
14405             CDS       T01002                                 

Gene name
Gabrg1, GabaA, GabaA/BZ
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit gamma 1
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14405 (Gabrg1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14405 (Gabrg1)
   04723 Retrograde endocannabinoid signaling
    14405 (Gabrg1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14405 (Gabrg1)
   05033 Nicotine addiction
    14405 (Gabrg1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14405 (Gabrg1)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   14405 (Gabrg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Motif
Other DBs
NCBI-GeneID: 14405
NCBI-ProteinID: NP_034382
MGI: 103156
Ensembl: ENSMUSG00000001260
Vega: OTTMUSG00000054188
UniProt: Q9R0Y8
Position
5 C3.1; 5 37.43 cM
AA seq 465 aa AA seqDB search
MGSGKAFLFSPSLLWSQTRGVRLIFLLLTLHLGNCVDKADDEDDEDLTMNKTWVLAPKIH
EGDITQILNSLLQGYDNKLRPDIGVRPTVIETDVYVNSIGPVDPINMEYTIDIIFAQTWF
DSRLKFNSTMKVLMLNSNMVGKIWIPDTFFRNSRKSDAHWITTPNRLLRIWSDGRVLYTL
RLTINAECYLQLHNFPMDEHSCPLEFSSYGYPKNEIEYKWKKPSVEVADPKYWRLYQFAF
VGLRNSTEISHTISGDYIIMTIFFDLSRRMGYFTIQTYIPCILTVVLSWVSFWINKDAVP
ARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFAALMEYGTLHYFTSN
NKGKTTRGRKLKNKTSASPGLHAGSTLIPMNSISLPQGEDDYGYQCLEGKDCTSFFCCFD
DCRTGSWREGRIHIRIAKIDSYSRIFFPTAFALFNLVYWVGYLYL
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgggttctgggaaagccttcctcttctctccttctctcctgtggagtcaaactagagga
gtgaggttgatattcttgttactaaccctgcatctgggaaactgtgtcgataaagcagat
gatgaagatgatgaagatttaactatgaacaaaacatgggtcttggcaccaaaaattcat
gaaggagatatcacacaaatcctcaactctttgcttcaaggttatgataacaaacttcgt
ccagatataggcgtgagacccacagtgattgaaacagatgtttatgtaaacagcattgga
cctgtggatcccataaacatggagtatacaatagacataatttttgcccaaacctggttt
gacagccgtttaaagttcaatagcaccatgaaagtacttatgctcaacagcaacatggtg
gggaaaatttggattcccgacactttcttcaggaactcaagaaaatcggatgcacactgg
ataacaacgcctaatcgcctgctgcggatttggagtgatggaagggttctctatactctt
cgattaacaattaatgcagagtgctaccttcaacttcataattttcctatggatgaacat
tcctgtccactggaattttcaagctatggataccctaaaaatgaaattgagtacaagtgg
aaaaagccctctgtggaagtagctgatcctaagtactggagattatatcagtttgcattt
gtagggttacgaaattctactgaaatctctcacacaatctctggagattatattatcatg
actattttttttgacctgagcagacggatgggctatttcacgattcagacatacattccg
tgtattctaacagtggttctttcctgggtgtctttttggatcaataaagatgcagtacct
gctagaacatccctgggtatcactacggttttgactatgacaaccctcagtacaattgct
agaaaatctttacctaaggtttcttacgtgacagcaatggatctctttgtctctgtgtgt
ttcatttttgtgtttgcagcactcatggaatacggaaccttgcattattttactagcaac
aataaaggaaaaaccaccagaggcaggaagctgaaaaacaagacttcggcttccccaggt
ctccatgctggatccactctcattcccatgaacagcatttctttgccacaaggggaagat
gattatggctaccagtgtttggagggcaaagactgtactagctttttctgttgcttcgat
gactgcagaactgggtcctggagggaagggcggatacacatacgcattgcaaaaattgac
tcctactccagaatctttttcccaacagcttttgccttgttcaatctggtttactgggtt
gggtatctatacttataa

DBGET integrated database retrieval system