KEGG   Mus musculus (mouse): 14407
Entry
14407             CDS       T01002                                 

Gene name
Gabrg3, 6330406O05Rik, B230362M20Rik, Gabrg-3
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit gamma 3
  KO
K05186  gamma-aminobutyric acid receptor subunit gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04723  Retrograde endocannabinoid signaling
mmu04727  GABAergic synapse
mmu05032  Morphine addiction
mmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14407 (Gabrg3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14407 (Gabrg3)
   04723 Retrograde endocannabinoid signaling
    14407 (Gabrg3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    14407 (Gabrg3)
   05033 Nicotine addiction
    14407 (Gabrg3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:mmu04040]
    14407 (Gabrg3)
Ion channels [BR:mmu04040]
 Ligand-gated channels
  GABA-A
   14407 (Gabrg3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 14407
NCBI-ProteinID: NP_032100
MGI: 95624
Ensembl: ENSMUSG00000055026
Vega: OTTMUSG00000024708
UniProt: P27681
Position
7 B5; 7 33.48 cM
AA seq 467 aa
MAAKLLLLLCLFSGLHARSRRVEEDENEDSPSNQKWVLAPKSQDTDVTLILNKLLREYDK
KLRPDIGIKPTVIDVDIYVNSIGPVSSINMEYQIDIFFAQTWTDSRLRFNSTMKILTLNS
NMVGLIWIPDTIFRNSKTAEAHWITTPNQLLRIWNDGKILYTLRLTINAECQLQLHNFPM
DAHACPLTFSSYGYPKEEMIYRWRKNSVEAADQKSWRLYQFDFMGLRNTTEIVTTSAGDY
VVMTIYFELSRRMGYFTIQTYIPCILTVVLSWVSFWIKKDATPARTTLGITTVLTMTTLS
TIARKSLPRVSYVTAMDLFVTVCFLFVFAALMEYATLNYYSSCRKPTIRKKKTSLLHPDS
TRWIPDRISLQAPSNYSLLDMRPPPPVMITLNNSMYWQEFEDTCVYECLDGKDCQSFFCC
YEECKSGSWRRGRIHIDVSELDSYSRVFFPTSFLLFNLVYWVGYLYL
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggctgcaaagctgctgcttctcctctgcctgttctcgggcttgcatgctcggtccagg
agggtagaagaagatgagaatgaagactccccatcaaaccagaagtgggtcttggcaccc
aaatcacaagacaccgatgtaacgctgattctcaacaaattgttgagagaatatgacaaa
aagctgagaccggacattggaataaaaccaactgtgatcgatgtggacatttatgttaac
agcattggtcctgtgtcatccataaacatggaataccaaattgatatattttttgctcaa
acctggacagacagtcgccttcgattcaacagcacaatgaaaatactaactctgaacagc
aacatggtgggcttgatatggattccagacaccatctttcgaaattctaaaacagcggag
gctcactggatcaccacacccaaccagctcctcagaatctggaatgatgggaaaatcctt
tacacattaaggctcactatcaatgcagagtgccagctgcaactgcataacttccctatg
gatgcgcatgcctgccccttgaccttctctagctatggctaccccaaagaagaaatgatt
tatcgttggaggaaaaattcagttgaggcagctgatcagaaatcatggcggctctatcag
tttgacttcatgggcctcagaaacactacagaaatcgtgacaacatctgcaggtgattat
gttgtcatgactatctattttgaactgagtcgaagaatgggatacttcacgatccagacg
tatatcccctgcatactgactgtggttctgtcctgggtgtcattttggataaaaaaggat
gcgacaccagcaagaacaacattaggcatcaccacggtgctaaccatgaccacactcagc
accattgccaggaagtctctgcctcgggtgtcctatgtcactgccatggacctctttgtg
actgtgtgcttcttgtttgtctttgccgcactgatggagtatgctacactcaactactat
tcaagctgtcgaaagccaaccatcaggaagaaaaaaacatcgttattacatccagattcc
acaagatggattcctgatcgaataagccttcaagcaccctctaattactctctactggac
atgaggcccccaccacctgtgatgatcacgttaaacaattccatgtactggcaggaattt
gaggacacctgtgtctatgagtgtctggatggcaaagactgccagagcttcttctgctgc
tatgaggagtgcaagtctggctcctggaggagaggccgcatccacattgatgtctctgag
ctggactcctactctcgggtcttcttcccgacatccttcctgctgttcaacctggtctat
tgggttggatacctgtatctttaa

DBGET integrated database retrieval system