KEGG   Mus musculus (mouse): 14412
Entry
14412             CDS       T01002                                 

Symbol
Slc6a13, GAT3, Gabt, Gabt3, Gat, Gat2
Name
(RefSeq) solute carrier family 6 (neurotransmitter transporter, GABA), member 13
  KO
K05046  solute carrier family 6 (neurotransmitter transporter, GABA) member 13
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04721  Synaptic vesicle cycle
mmu04727  GABAergic synapse
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    14412 (Slc6a13)
   04721 Synaptic vesicle cycle
    14412 (Slc6a13)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mmu02000]
    14412 (Slc6a13)
Transporters [BR:mmu02000]
 Solute carrier family (SLC)
  SLC6: Sodium- and chloride-dependent neurotransmitter transporter
   14412 (Slc6a13)
SSDB
Motif
Pfam: SNF
Other DBs
NCBI-GeneID: 14412
NCBI-ProteinID: NP_653095
MGI: 95629
Ensembl: ENSMUSG00000030108
Vega: OTTMUSG00000023510
UniProt: P31649
Position
6; 6 F1
AA seq 602 aa
MENRASGTTSNGETKPVCPAMEKVEEDGTLEREHWNNKMEFVLSVAGEIIGLGNVWRFPY
LCYKNGGGAFFIPYLIFLFTCGIPVFFLETALGQYTNQGGITAWRRICPIFEGIGYASQM
IVSLLNVYYIVVLAWALFYLFSSFTTDLPWGSCSHEWNTENCVEFQKANDSMNVTSENAT
SPVIEFWERRVLKLSDGIQHLGSLRWELVLCLLLAWIICYFCIWKGVKSTGKVVYFTATF
PYLMLVVLLIRGVTLPGAAQGIQFYLYPNITRLWDPQVWMDAGTQIFFSFAICLGCLTAL
GSYNKYHNNCYRDCIALCILNSSTSFMAGFAIFSILGFMSQEQGVPISEVAESGPGLAFI
AYPRAVVMLPFSPLWACCFFFMVVLLGLDSQFVCVESLVTALVDMYPRVFRKKNRREVLI
LIVSVISFFIGLIMLTEGGMYVFQLFDYYAASGMCLLFVAIFESLCVAWVYGAGRFYDNI
EDMIGYKPWPLIKYCWLFFTPAVCLATFLFSLIKYTPLTYNKKYTYPWWGDALGWLLALS
SMICIPAWSIYKLRTLKGPLRERLRQLVCPAEDLPQKNQPEPTAPATPMTSLLRLTELES
NC
NT seq 1809 nt   +upstreamnt  +downstreamnt
atggagaacagggcctcgggaacaaccagtaatggagagacaaagccagtgtgtccagcc
atggagaaagtggaggaagatggtaccctggaacgggagcactggaacaacaagatggag
tttgtgctgtctgtggctggggagatcattggcttaggcaacgtctggaggtttccctat
ctctgctacaagaacgggggaggtgccttctttatcccctacctcatcttcctttttacc
tgtggcatccctgtcttcttcttggagacagcgcttggccagtacaccaaccagggaggc
atcacagcctggaggagaatctgtcccatctttgaaggcatcggctatgcctcacagatg
atcgtcagcctcctcaatgtctactacatcgttgtcctggcctgggccctcttctacctc
ttcagcagcttcaccactgacctcccctggggaagttgcagccatgagtggaatacagaa
aactgtgtggaattccagaaggccaatgattccatgaatgtgacctccgagaatgccacc
tcccctgtcatcgagttctgggagaggcgagtcctgaagctctcggatggcatccagcac
ctggggtccctgcgctgggaactggtcctgtgcctcctgctcgcctggatcatctgctac
ttctgcatctggaagggggtcaagtccacgggcaaggtggtctacttcacagccactttc
ccttacctcatgctggtggtcctgttgattcgaggagtgacactgcccggagcagcccaa
ggaattcagttttacctgtaccccaacatcacacgtctgtgggatccccaggtgtggatg
gatgcaggcacccagatcttcttctcctttgccatctgtctggggtgcctcacggccctg
ggaagctacaacaagtaccacaacaattgctacagggactgcatcgccctttgcatcctc
aacagcagcaccagcttcatggccgggtttgctatcttctccatcctgggcttcatgtct
caggagcagggtgtgcccatatctgaggttgctgaatcaggccctggcctggcattcatc
gcctaccctcgagctgtggtgatgttacccttctcaccgttgtgggcctgctgtttcttc
ttcatggtcgttctcctgggactagatagccagtttgtgtgtgtagaaagccttgtgaca
gcattagtggacatgtatccccgggtgttccgtaagaagaatcggagggaggtcctcatc
cttattgtgtccgtcatctcgttcttcatcgggctcatcatgctcacagagggcggcatg
tacgtgttccagctctttgactactatgcagccagtggcatgtgtcttctcttcgtggcc
atctttgagtccctctgtgtggcttgggtttatggagccggccgcttctacgacaacatt
gaggatatgattgggtataagccatggcctcttatcaaatattgttggctctttttcacg
ccagctgtgtgcctggcgaccttcctgttctccctgatcaaatacacgccactgacctac
aacaagaagtacacgtacccatggtggggggatgccctagggtggctcctagctctgtcc
tccatgatctgcattcctgcctggagcatctacaagctgaggactctcaagggcccactc
agagagagacttcgccagctcgtgtgcccggctgaagaccttccccagaagaaccaacca
gagccaactgctcctgcgacaccgatgacatcccttctcaggctcacagaactggagtct
aactgctag

DBGET integrated database retrieval system