KEGG   Mus musculus (mouse): 14419
Entry
14419             CDS       T01002                                 

Gene name
Gal, G, Galn
Definition
(RefSeq) galanin and GMAP prepropeptide
  KO
K05244  galanin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14419 (Gal)
SSDB
Motif
Pfam: GMAP Galanin
Other DBs
NCBI-GeneID: 14419
NCBI-ProteinID: NP_034383
MGI: 95637
Ensembl: ENSMUSG00000024907
UniProt: P47212 Q3V002
Position
19 A; 19 3.16 cM
AA seq 124 aa
MARGSVILLGWLLLVVTLSATLGLGMPAKEKRGWTLNSAGYLLGPHAIDNHRSFSDKHGL
TGKRELQLEVEERRPGSVDVPLPESNIVRTIMEFLSFLHLKEAGALDSLPGIPLATSSED
LEKS
NT seq 375 nt   +upstreamnt  +downstreamnt
atggccagaggcagcgttatcctgctaggctggctcctgttggttgtgaccctgtcagcc
actctgggacttgggatgcctgcaaaggagaagagaggttggaccctgaacagcgctggc
taccttctgggcccacatgccattgacaaccacagatcatttagcgacaagcatggcctc
acaggcaagagggagttacaactggaggtggaggaaaggagaccaggaagtgttgatgtg
cccctgcctgagagcaacattgtccgcactataatggagtttctcagtttcttgcacctt
aaagaggccggggccctcgacagcctgcctggcatccccttggccacctcctcagaagac
ctagagaagtcctga

DBGET integrated database retrieval system