KEGG   Mus musculus (mouse): 14431
Entry
14431             CDS       T01002                                 

Gene name
Gamt, AA571402, Spintz1
Definition
(RefSeq) guanidinoacetate methyltransferase
  KO
K00542  guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00330  Arginine and proline metabolism
mmu01100  Metabolic pathways
Module
mmu_M00047  Creatine pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    14431 (Gamt)
   00330 Arginine and proline metabolism
    14431 (Gamt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.2  guanidinoacetate N-methyltransferase
     14431 (Gamt)
SSDB
Other DBs
NCBI-GeneID: 14431
NCBI-ProteinID: NP_034385
MGI: 1098221
Ensembl: ENSMUSG00000020150
Vega: OTTMUSG00000000008
UniProt: O35969
Position
10 C1; 10 39.72 cM
AA seq 236 aa
MSSSAASPLFAPGEDCGPAWRAAPAAYDASDTHLQILGKPVMERWETPYMHALAAAAASR
GGRVLEVGFGMAIAASRVQQAPIEEHWIIECNDGVFQRLQDWALRQPHKVVPLKGLWEEV
APTLPDGHFDGILYDTYPLSEEAWHTHQFNFIKNHAFRLLKTGGVLTYCNLTSWGELMKS
KYTDITTMFEETQVPALQEAGFLKENICTEVMALVPPADCRYYAFPQMITPLVTKH
NT seq 711 nt   +upstreamnt  +downstreamnt
atgagctcttctgcagctagcccgctcttcgcgcccggcgaggactgcggccccgcgtgg
cgcgcggcccccgcggcctatgacgcgtctgacacgcacctgcaaatcctgggcaagcca
gtgatggagcgttgggagaccccctatatgcatgcgctagcggcggctgctgcctccaga
gggggccgggtcttggaagtgggcttcggtatggccattgcagcctccagggtgcaacag
gcccccatagaggaacactggattattgagtgcaatgatggggtcttccagcgtctacaa
gactgggccctgcggcagccacataaggttgttcccttgaaaggcctgtgggaggaggtg
gcacctaccctgcctgacggtcactttgatgggattctatatgacacgtacccgctgtct
gaagaggcctggcacactcaccagttcaactttattaagaatcatgccttccgcttgctg
aagaccgggggcgtcctcacctactgcaacctcacgtcctggggggagctcatgaagtcc
aaatacacagacatcaccaccatgtttgaggagacgcaggtgcctgcactgcaggaagct
ggcttcctgaaagaaaacatctgcacagaggtgatggcactggtgcccccagccgactgc
cgctactatgccttccctcagatgatcacacccctggtcaccaagcactga

DBGET integrated database retrieval system