KEGG   Mus musculus (mouse): 14432Help
Entry
14432             CDS       T01002                                 

Gene name
Gap43, B-50, Basp2, GAP-43
Definition
(RefSeq) growth associated protein 43
  KO
K20041  neuromodulin
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14432 (Gap43)
Membrane trafficking [BR:mmu04131]
 SNARE
  SNARE associated proteins
   Others
    14432 (Gap43)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neuromodulin Neuromodulin_N IQ
Motif
Other DBs
NCBI-GeneID: 14432
NCBI-ProteinID: NP_032109
MGI: 95639
Ensembl: ENSMUSG00000047261
Vega: OTTMUSG00000016275
UniProt: P06837
Position
16 B4; 16 28.37 cM
AA seq 227 aa AA seqDB search
MLCCMRRTKQVEKNDEDQKIEQDGVKPEDKAHKAATKIQASFRGHITRKKLKGEKKGDAP
AAEAEAKEKDDAPVADGVEKKEGDGSATTDAAPATSPKAEEPSKAGDAPSEEKKGEGDAA
PSEEKAGSAETESAAKATTDNSPSSKAEDGPAKEEPKQADVPAAVTDAAATTPAAEDAAT
KAAQPPTETAESSQAEEEKDAVDEAKPKESARQDEGKEDPEADQEHA
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgctgtatgagaagaaccaaacaggttgaaaagaatgatgaggaccaaaagatt
gaacaagatggtgtcaagccggaagataaggctcataaggctgcgaccaaaattcaggct
agcttccgtggacacataacaaggaaaaagctcaaaggcgagaagaagggtgatgcacca
gctgctgaggccgaggccaaggagaaggatgatgctcccgttgctgatggtgtggagaag
aaggagggagatggctctgctactaccgatgcagccccagccaccagccccaaggctgag
gagcccagcaaggcaggagatgcaccttctgaggagaagaagggtgaaggggatgcggcc
ccctccgaggaaaaggccggctcagcggagacagaaagtgctgctaaagctaccactgat
aactccccgtcctccaaggctgaagatggcccagccaaggaggagcctaaacaagccgat
gtgcctgctgctgtcactgatgctgctgccaccacccctgctgcagaggatgctgccacc
aaggcagcgcagcctccaacggagactgcagaaagcagccaagctgaggaggagaaagac
gctgtagacgaagccaaacctaaggaaagtgcccgacaggatgagggtaaagaagacccc
gaggctgaccaagaacatgcctga

DBGET integrated database retrieval system