KEGG   Mus musculus (mouse): 14433
Entry
14433             CDS       T01002                                 

Gene name
Gapdh, Ga, Gapd
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase
  KO
K00134  glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00010  Glycolysis / Gluconeogenesis
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
mmu04066  HIF-1 signaling pathway
mmu05010  Alzheimer disease
mmu05132  Salmonella infection
Module
mmu_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmu_M00002  Glycolysis, core module involving three-carbon compounds
mmu_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    14433 (Gapdh)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    14433 (Gapdh)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    14433 (Gapdh)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    14433 (Gapdh)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    14433 (Gapdh)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    14433 (Gapdh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     14433 (Gapdh)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    14433 (Gapdh)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14433 (Gapdh)
SSDB
Motif
Pfam: Gp_dh_C Gp_dh_N DapB_N
Other DBs
NCBI-GeneID: 14433
NCBI-ProteinID: NP_032110
MGI: 95640
Ensembl: ENSMUSG00000057666
Vega: OTTMUSG00000027118
UniProt: P16858 D2KHZ9
Position
6 F2; 6 59.32 cM
AA seq 333 aa
MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKA
ENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIIS
APSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAIT
ATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSV
VDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIA
LNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggtgaaggtcggtgtgaacggatttggccgtattgggcgcctggtcaccagggctgcc
atttgcagtggcaaagtggagattgttgccatcaacgaccccttcattgacctcaactac
atggtctacatgttccagtatgactccactcacggcaaattcaacggcacagtcaaggcc
gagaatgggaagcttgtcatcaacgggaagcccatcaccatcttccaggagcgagacccc
actaacatcaaatggggtgaggccggtgctgagtatgtcgtggagtctactggtgtcttc
accaccatggagaaggccggggcccacttgaagggtggagccaaaagggtcatcatctcc
gccccttctgccgatgcccccatgtttgtgatgggtgtgaaccacgagaaatatgacaac
tcactcaagattgtcagcaatgcatcctgcaccaccaactgcttagcccccctggccaag
gtcatccatgacaactttggcattgtggaagggctcatgaccacagtccatgccatcact
gccacccagaagactgtggatggcccctctggaaagctgtggcgtgatggccgtggggct
gcccagaacatcatccctgcatccactggtgctgccaaggctgtgggcaaggtcatccca
gagctgaacgggaagctcactggcatggccttccgtgttcctacccccaatgtgtccgtc
gtggatctgacgtgccgcctggagaaacctgccaagtatgatgacatcaagaaggtggtg
aagcaggcatctgagggcccactgaagggcatcttgggctacactgaggaccaggttgtc
tcctgcgacttcaacagcaactcccactcttccaccttcgatgccggggctggcattgct
ctcaatgacaactttgtcaagctcatttcctggtatgacaatgaatacggctacagcaac
agggtggtggacctcatggcctacatggcctccaaggagtaa

DBGET integrated database retrieval system