KEGG   Mus musculus (mouse): 14459Help
Entry
14459             CDS       T01002                                 

Gene name
Gast, GAS
Definition
(RefSeq) gastrin
  KO
K13768  gastrin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    14459 (Gast)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gastrin
Motif
Other DBs
NCBI-GeneID: 14459
NCBI-ProteinID: NP_034387
MGI: 104768
Ensembl: ENSMUSG00000017165
Vega: OTTMUSG00000006278
UniProt: P48757
Position
11 D; 11 63.46 cM
AA seq 101 aa AA seqDB search
MPRLCVYMLVLVLALATFSEASWKPRSQLQDASSGPGTNEDLEQRQFNKLGSASHHRRQL
GPQGPQHFIADLSKKQRPRMEEEEEAYGWMDFGRRSAEEDQ
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgactgtgtgtgtacatgctggtcttagtgctggctctagctaccttctcggaa
gcttcttggaagccccgctcccagctacaggatgcatcatctggaccagggaccaatgag
gacctggaacagcgccagttcaacaagctgggctcagcctctcaccatcgaaggcagctg
gggccccagggtcctcaacacttcatagcagacctgtccaagaagcagaggccacgaatg
gaggaagaagaagaggcctacggatggatggactttggccgccgcagtgctgaggaagac
cagtag

DBGET integrated database retrieval system