KEGG   Mus musculus (mouse): 14460
Entry
14460             CDS       T01002                                 

Gene name
Gata1, Gata, Gata-1, Gf-1, eryf1
Definition
(RefSeq) GATA binding protein 1
  KO
K09182  GATA-binding protein 1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14460 (Gata1)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    14460 (Gata1)
SSDB
Motif
Pfam: GATA TF_Zn_Ribbon DUF5529 Zn-ribbon_8 DZR_2 ArfGap
Other DBs
NCBI-GeneID: 14460
NCBI-ProteinID: NP_032115
MGI: 95661
Ensembl: ENSMUSG00000031162
Vega: OTTMUSG00000018011
UniProt: P17679
Structure
PDB: 

Position
X A1.1; X 3.59 cM
AA seq 413 aa
MDFPGLGALGTSEPLPQFVDSALVSSPSDSTGFFSSGPEGLDAASSSTSPNAATAAASAL
AYYREAEAYRHSPVFQVYPLLNSMEGIPGGSPYASWAYGKTALYPASTVCPSHEDAPSQA
LEDQEGKSNNTFLDTLKTERLSPDLLTLGTALPASLPVTGSAYGGADFPSPFFSPTGSPL
SSAAYSSPKFHGSLPLAPCEARECVNCGATATPLWRRDRTGHYLCNACGLYHKMNGQNRP
LIRPKKRMIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYFKLHQVNRPLTMRKD
GIQTRNRKASGKGKKKRGSNLAGAGAAEGPAGGFMVVAGSSSSGNCGEVASGLALGTAGT
AHLYQGLGPVVLSGPVSHLMPFPGPLLGSPTTSFPTGPAPTTSSTSVIAPLSS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggattttcctggtctaggggccctggggacctcagaacccttgccccagtttgtggat
tctgccctggtgtcctcaccatcagattccacaggtttcttttcctctgggccagagggt
ttggatgcagcatcttcttccacttccccaaatgcagccacggccgcagcatcagcactg
gcctactacagagaagctgaggcctacagacactccccagtctttcaggtgtatccactg
ctcaacagtatggagggaattcctgggggctcaccttatgctagctgggcctatggcaag
acggcactctaccctgcctcaactgtgtgccccagccatgaggatgccccttcccaggcc
ctggaagaccaggaagggaagagcaacaacacgttcttggacaccttgaagacggagcgg
ctgagtccagacctcctgacgctggggactgcactgcctgcatcgctccctgtcaccggc
agtgcttacgggggagctgactttcccagtcctttcttctctcccactgggagccctctc
agctcagcagcctattcttcccccaagtttcatggaagcctgccattggccccttgtgag
gccagagagtgtgtgaactgtggagcaacggctactccactgtggcggagggacaggaca
ggtcactacctgtgcaatgcctgtggcttgtatcacaagatgaatggtcagaaccggcct
ctcatccggcccaagaagcgaatgattgtcagcaaacgggcaggcacccaatgcactaac
tgtcaaacgaccactacaacactctggcggaggaatgccagcggagatccggtatgcaat
gcctgcggcctctatttcaagctccatcaggtgaaccgcccactgaccatgaggaaagat
ggaatccagacgaggaaccgcaaggcatctggcaaagggaaaaagaagcgggggtcgaat
ctggctggagcgggagcggctgaaggaccagctggtggcttcatggtggtagctggtagc
agcagtagtgggaattgtggggaggtggcctcaggcttggcactgggcactgcaggtact
gcccacctctatcagggcctaggacctgtggtactgtcagggcctgtcagccatcttatg
ccttttcctggacctctgctgggatcgcctacaacctccttccccaccggtcctgcacct
accaccagcagcaccagcgtgatcgccccactcagttcttga

DBGET integrated database retrieval system