KEGG   Mus musculus (mouse): 14463Help
Entry
14463             CDS       T01002                                 

Gene name
Gata4, Gata-4
Definition
(RefSeq) GATA binding protein 4
  KO
K09183  GATA-binding protein 4
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04022  cGMP-PKG signaling pathway
mmu04218  Cellular senescence
mmu04530  Tight junction
mmu04919  Thyroid hormone signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    14463 (Gata4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    14463 (Gata4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    14463 (Gata4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    14463 (Gata4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    14463 (Gata4)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 GATA-factors
    14463 (Gata4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GATA-N GATA TF_Zn_Ribbon Zn-ribbon_8 Apidaecin ArfGap Prim_Zn_Ribbon
Motif
Other DBs
NCBI-GeneID: 14463
NCBI-ProteinID: NP_032118
MGI: 95664
Ensembl: ENSMUSG00000021944
Vega: OTTMUSG00000032593
UniProt: Q08369 Q3UYJ1
Position
14 D1; 14 33.24 cM
AA seq 441 aa AA seqDB search
MYQSLAMAANHGPPPGAYEAGGPGAFMHSAGAASSPVYVPTPRVPSSVLGLSYLQGGGSA
AAAGTTSGGSSGAGPSGAGPGTQQGSPGWSQAGAEGAAYTPPPVSPRFSFPGTTGSLAAA
AAAAAAREAAAYGSGGGAAGAGLAGREQYGRPGFAGSYSSPYPAYMADVGASWAAAAAAS
AGPFDSPVLHSLPGRANPGRHPNLDMFDDFSEGRECVNCGAMSTPLWRRDGTGHYLCNAC
GLYHKMNGINRPLIKPQRRLSASRRVGLSCANCQTTTTTLWRRNAEGEPVCNACGLYMKL
HGVPRPLAMRKEGIQTRKRKPKNLNKSKTPAGPAGETLPPSSGASSGNSSNATSSSSSSE
EMRPIKTEPGLSSHYGHSSSMSQTFSTVSGHGPSIHPVLSALKLSPQGYASPVTQTSQAS
SKQDSWNSLVLADSHGDIITA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgtaccaaagcctggccatggccgccaaccacggccccccgcccggcgcctacgaagca
ggtggccctggcgccttcatgcacagcgcgggcgccgcgtcctcgcccgtctacgtgccc
actccgcgggtgccgtcctctgtgctgggcctgtcctacctgcagggcggtggcagtgcc
gctgcagctggaaccacctcgggtggcagctccggggccggcccgtcgggtgcagggcct
gggacccagcagggtagccctggctggagccaagctggagccgagggagccgcctacacc
ccgccgcccgtgtccccgcgcttctctttcccggggactactgggtccctggcggccgct
gccgccgctgccgcagcccgggaagctgcagcctacggcagtggcggcggggcggcgggc
gctggtctggctggccgagagcagtacgggcgtccgggcttcgccggctcctactccagc
ccctacccagcctacatggccgacgtgggagcatcctgggccgcagccgctgccgcctct
gccggccccttcgacagcccagtcctgcacagcctgcctggacgggccaaccctggaaga
caccccaatctcgatatgtttgatgacttctcagaaggcagagagtgtgtcaattgtggg
gccatgtccaccccactctggaggcgagatgggacgggacactacctgtgcaatgcctgt
ggcctctatcacaagatgaacggcatcaaccggcccctcattaagcctcagcgccgcctg
tccgcttcccgccgggtaggcctctcctgtgccaactgccagactaccaccaccacgctg
tggcgtcgtaatgccgagggtgagcctgtatgtaatgcctgcggcctctacatgaagctc
catggggttcccaggcctcttgcaatgcggaaggaggggattcaaaccagaaaacggaag
cccaagaacctgaataaatctaagacgccagcaggtcctgctggtgagaccctccctccc
tccagtggtgcctccagcggtaactccagcaatgccactagcagcagcagcagcagtgaa
gagatgcgccccatcaagacagagcccgggctgtcatctcactatgggcacagcagctcc
atgtcccagacattcagtactgtgtccggccacgggccctccatccatccagtgctgtct
gctctgaagctgtccccacaaggctatgcatctcctgtcactcagacatcgcaggccagc
tccaagcaggactcttggaacagcctggtcctggctgacagtcatggggacataatcacc
gcgtaa

DBGET integrated database retrieval system